Identifiers and Description

Gene Model Identifier

SteCoe_29714

Standard Name

None

Aliases

None

Description

SNF2_N domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Oxytricha TrifallaxContig16241.0.g1020SNF2 family N-terminal domain

WormBaseWBGene000021690

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_29714(Protein)
MEPEANSPISDGSNSLEDTLKHHQNFAKKLKIEQKKFIKQSKDQNEKLGYLLSQAEHYAN
FLFNGEYNLSSETAQKRNNRKKRIIRSKDDDDIIDDMSYERKLTRINSQPSIIKNGELRS
YQIDGVNWLISLYRTGINGILADEMGLGKTIQTIAFLAYLREQEGIKGPHLIVVPKSTLG
NWIKEFDKWCPIIKTVKLIAAKPYREEIIKNELVPGKFDVCITSYEGINLCHSTLKKFTW
KFLIIDEAHKIKNDESNLSQLIRKLGTINRLLITGTPLQNNLHELWSLLNFLLPDLFASS
SDFDEWFNLGAEEGLSENEIERKNVKMVQQLHKILKPFILRRTKLEVERGIPPKKEIIVT
TGMTPMQKDLYKKILTNELCKQDNKSHYLNIVMQLRKVCNHPYLFPKVEDETENDYGEHL
ILNSGKMKLIDRLLAKLKDQNSQILIFSQMTTMLDILEDYCNYREYKFCRLDGTTDIYER
EKMMSKFTKPGSKYFIFLLSTRAGGLGINLASADTVIIFDSDWNPQMDLQAMDRAHRIGQ
TKQVNVYRLVTKDSLEERMIERQCLRLKLDSLVIQTGRLAPRHKSLDKEELQEMLHYGAD
QIFNAIADDSDITEEELALILQRGEQKLNHISNELEIQLEKKKNLIDFESKIDMWNFESI
DYSKKRKEESRDVIQKAIHDKILEELNARRERKMQTIYNLDSKFSFNTSGSSKPKEFKPA
PDFKFYENRIRLIELQKKDFAKEINEEEKVELEKLLSTGFDWNRKDYNAFIKACELYGKD
EYPMIAEVMGNKNEEQVKKYSEVFWSRLDELADKEKIIKTIEKRESLVEKHKHSQIILDQ
KFSQYKDPWRDLTFDTTSSHKSRIFTNENDRYLICMAKLVGYGNWDVLKSRIRKSFMFKF
DYMLRSRTSGELQRRVDSLIRILEKEIEEKKNPPELGKRKKEASGEPPLVKVQKTVESHG
IEDFFTAK


>SteCoe_29714(CDS)
ATGGAACCTGAGGCTAATTCCCCTATTAGCGATGGCTCAAATTCTTTAGAAGATACCTTA
AAACACCATCAGAATTTCGCCAAAAAACTTAAAATCGAGCAGAAAAAATTCATCAAGCAG
TCCAAAGACCAAAATGAAAAGCTAGGCTATCTTCTTTCCCAAGCAGAACATTATGCAAAT
TTCCTCTTCAATGGCGAATATAATTTATCATCGGAAACGGCTCAGAAACGCAACAATCGT
AAAAAGCGAATCATCAGAAGCAAAGATGATGATGATATTATTGATGATATGTCTTATGAA
CGTAAACTGACTCGGATAAATTCTCAGCCTTCAATCATCAAAAACGGAGAACTTCGGTCT
TACCAGATAGATGGGGTAAATTGGCTTATAAGTTTGTATAGGACAGGGATTAATGGGATT
TTAGCTGATGAGATGGGCTTGGGCAAAACCATTCAGACGATAGCATTTTTGGCGTATTTG
CGTGAGCAGGAGGGCATAAAAGGTCCACATTTAATTGTAGTCCCTAAATCCACACTTGGC
AACTGGATAAAGGAGTTCGACAAATGGTGTCCGATTATCAAAACTGTAAAGCTAATAGCC
GCTAAGCCTTACCGAGAAGAAATAATCAAAAACGAACTAGTTCCAGGGAAGTTTGATGTA
TGCATTACAAGTTATGAAGGCATAAACCTCTGCCACAGCACCTTAAAAAAGTTTACATGG
AAGTTCTTAATCATAGACGAGGCACACAAAATCAAAAACGACGAGTCCAACTTATCACAA
TTAATAAGAAAACTCGGAACTATAAACCGACTTCTTATAACAGGAACTCCTTTACAAAAC
AATTTACATGAACTATGGAGTTTACTAAATTTCCTTTTACCTGACTTGTTTGCTTCAAGT
TCTGACTTTGATGAATGGTTCAATCTTGGTGCTGAAGAAGGTCTTTCAGAGAATGAGATA
GAGAGAAAAAACGTAAAAATGGTTCAACAATTGCATAAAATCCTAAAACCTTTTATATTA
AGAAGAACTAAGCTTGAGGTTGAAAGAGGAATCCCCCCTAAGAAAGAAATCATTGTGACT
ACAGGGATGACCCCAATGCAAAAAGATTTATATAAGAAAATACTCACTAATGAGCTATGT
AAACAAGATAATAAAAGTCATTATTTGAATATAGTTATGCAATTAAGGAAAGTTTGTAAT
CATCCATACTTGTTCCCAAAAGTTGAAGATGAGACAGAAAATGATTATGGGGAGCATTTG
ATATTGAATTCAGGGAAAATGAAACTTATAGACAGACTTTTGGCTAAGCTTAAAGACCAA
AACTCTCAGATACTGATTTTTTCTCAGATGACGACTATGTTGGATATACTTGAAGACTAC
TGCAATTATCGAGAGTATAAATTTTGCCGTTTAGATGGGACAACTGATATTTATGAACGT
GAAAAAATGATGTCTAAGTTCACCAAACCAGGGTCGAAGTACTTCATTTTCCTATTGTCA
ACCAGAGCTGGAGGTCTTGGTATAAACTTAGCTTCAGCAGATACGGTTATTATTTTTGAC
TCAGATTGGAACCCTCAAATGGATTTACAAGCTATGGATAGGGCTCATCGTATTGGGCAA
ACTAAACAAGTTAATGTTTATCGTTTAGTTACTAAAGATTCCTTAGAAGAAAGAATGATT
GAACGCCAGTGTTTAAGATTAAAACTTGACTCTTTAGTTATACAAACTGGACGATTAGCT
CCTCGGCATAAGTCTTTAGATAAAGAAGAACTTCAGGAAATGCTTCATTATGGAGCTGAT
CAGATTTTTAATGCAATAGCAGATGACAGCGATATAACTGAAGAAGAGTTGGCTTTAATC
TTACAAAGAGGTGAGCAAAAACTCAACCATATTTCAAACGAACTCGAAATCCAGCTAGAA
AAAAAGAAAAATCTCATTGATTTTGAGAGTAAAATCGATATGTGGAACTTTGAAAGCATT
GACTACTCTAAAAAACGTAAAGAGGAATCAAGAGATGTTATACAAAAAGCAATACATGAT
AAAATACTTGAAGAACTTAATGCTAGAAGGGAAAGGAAAATGCAGACGATATACAATTTG
GACAGCAAGTTTAGTTTTAATACAAGTGGATCTTCGAAACCTAAGGAATTTAAACCGGCT
CCTGATTTTAAGTTTTATGAGAATAGGATAAGATTAATTGAGTTGCAGAAAAAGGATTTT
GCTAAAGAGATTAATGAAGAGGAAAAAGTTGAACTTGAAAAACTCTTGAGTACTGGTTTT
GATTGGAATAGAAAGGATTATAATGCGTTTATTAAGGCTTGTGAGCTTTATGGAAAAGAT
GAGTATCCGATGATTGCTGAAGTGATGGGGAATAAAAATGAGGAACAGGTTAAAAAGTAC
TCAGAGGTATTTTGGAGTAGACTTGATGAGTTAGCAGATAAGGAAAAAATTATTAAGACA
ATTGAAAAAAGGGAGAGCTTGGTGGAAAAACACAAACACTCACAGATTATATTAGACCAG
AAGTTTTCTCAGTACAAGGACCCATGGAGGGATTTGACTTTTGACACAACTTCTTCACAT
AAGTCAAGAATTTTCACTAATGAAAATGACAGGTACTTGATTTGTATGGCGAAACTTGTT
GGATATGGAAACTGGGATGTCTTGAAAAGTCGTATTCGGAAAAGTTTCATGTTTAAATTC
GATTATATGTTAAGATCACGTACATCTGGAGAGCTTCAAAGAAGAGTTGATAGTCTTATT
AGAATATTAGAAAAAGAGATTGAAGAGAAGAAAAACCCCCCTGAGCTTGGGAAGAGGAAA
AAAGAAGCTTCTGGGGAGCCTCCTCTTGTAAAGGTCCAGAAAACTGTAGAGTCACATGGT
ATTGAGGATTTTTTCACAGCAAAGTAA