Identifiers and Description

Gene Model Identifier

SteCoe_29794

Standard Name

None

Aliases

None

Description

MMR_HSR1 domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
WormBaseWBGene000153464.020060215743355e-74
Tetrahymena ThermophilaTTHERM_003163601.1983630608508849e-70GTP1/OBG family protein
Oxytricha TrifallaxContig21926.0.g91.7785284761271306e-6850S ribosome-binding GTPase

Saccharomyces CerevisiaeYGR173W8.628801156620959e-60Protein with a role in transla
tion; forms a complex with Gir
2p; has similarity to mammalia
n developmentally regulated GT
P-binding protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_29794(Protein)
MGVLERIKEIELEMSRTQKNKATEGHLGLLKARMAKLKAQLLEPPKGGGGKAEGFDVGKY
GDARVALIGFPSVGKSTLLSTVTPTQSEAAAYEFTTLTCIPGIVNYKGATIQLLDLPGII
EGASEGKGRGRQVIAVGRSADLILMVLDAQRSSEQKEKITQELESVGIRLNQRRPDITFQ
KKAQNGVMFNSTCQLTHMNQEIARKICHEYKIFHAEILFREDATVDQFIDIIEKKNRSYI
PCLYVYNKIDNISIEEINDLARQDDSVVISCNMQLNMDYLIERIWQKLGLVRVYTKKPGN
KPDFSQPLILTERRDGHSIEAACTQIHRELASDFRCAFVWGKSTKHYAQRCGLKHQLCDE
DVVQILKKNK


>SteCoe_29794(CDS)
ATGGGTGTGCTGGAAAGAATCAAGGAAATCGAACTGGAGATGTCCCGTACACAAAAAAAC
AAAGCAACAGAAGGGCATTTAGGCTTACTTAAAGCAAGAATGGCTAAGCTTAAAGCCCAG
TTGCTAGAGCCTCCAAAAGGTGGTGGTGGTAAAGCAGAAGGTTTTGATGTAGGTAAATAC
GGTGATGCTAGAGTAGCTTTAATAGGTTTTCCAAGTGTGGGTAAGTCAACATTATTAAGT
ACAGTGACTCCAACTCAATCAGAAGCAGCAGCATATGAGTTTACAACTTTAACTTGTATT
CCTGGAATTGTAAACTATAAAGGTGCAACAATTCAACTTTTAGATCTTCCTGGAATTATA
GAAGGTGCTTCAGAAGGTAAAGGACGTGGAAGACAAGTTATAGCAGTTGGAAGATCAGCT
GATTTGATTTTAATGGTCTTAGATGCACAGCGTTCATCAGAACAGAAAGAAAAAATCACA
CAAGAACTTGAATCTGTTGGGATAAGGCTTAATCAACGAAGACCTGATATTACATTCCAG
AAAAAAGCTCAGAATGGAGTTATGTTTAATTCGACTTGTCAATTAACTCATATGAATCAG
GAAATTGCTAGAAAGATTTGTCATGAATACAAGATTTTCCATGCTGAGATTTTGTTTAGG
GAAGATGCTACTGTAGACCAATTTATTGATATTATTGAAAAAAAGAACCGTAGTTATATA
CCTTGTTTGTATGTGTACAATAAGATAGATAATATTTCTATTGAAGAAATCAATGACCTT
GCAAGACAGGATGATTCTGTTGTTATATCTTGTAACATGCAACTTAATATGGATTATTTG
ATTGAGAGGATTTGGCAGAAACTTGGTTTGGTTAGAGTTTATACGAAAAAACCTGGAAAT
AAACCTGACTTTTCTCAGCCTTTAATACTAACAGAAAGAAGAGATGGCCATTCAATAGAA
GCTGCTTGCACGCAAATACATAGAGAACTTGCTAGTGATTTCAGATGCGCTTTTGTTTGG
GGAAAAAGTACAAAGCACTATGCTCAAAGATGTGGGCTCAAACATCAGTTGTGTGATGAA
GATGTTGTGCAGATACTTAAGAAAAATAAATAG