Identifiers and Description

Gene Model Identifier

SteCoe_29949

Standard Name

None

Aliases

None

Description

Sortilin-Vps10 domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Tetrahymena ThermophilaTTHERM_004673905.440559879258653e-75BNR/Asp-box repeat family/ VPS
10 domain containing protein
Oxytricha TrifallaxContig4955.0.0.g746.542840619051457e-69BNR/Asp-box repeat

Saccharomyces CerevisiaeYNR065C5.380186160021138e-32Protein of unknown function; p
rotein-protein interactions su
ggest a possible role in actin
patch formation; YNR065C is n
ot an essential gene

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_29949(Protein)
MEKLWLIILIASALAVNEDKIEFKQLEIDSEISEVLYCGAKKDTIIIITDEKQAYRSENS
GFSWKQISSEDKTMKVEKVVFSKADSKLVAFLGKDGKNWYSEDCGKTLKTINHGNLIEDF
RFHPKMRAWGLAVSWAKCSEVSEIDCSKTRVLYLTKDLGSTWNPILDFVVQFSWGHDGLN
DKITKNLPIERIYVTRNNNPSSDKQTGWNINVDFMCSDDFFSSKNLMVRYGNKFLLADKF
IFVAAAVEDDPEEVKLMVASDSDIENFVKAELPVKKIPEHSYTLLDTSEGAIFLHANHYG
TRSNYGTIYISDGTGKRFSISLLHNVREKKGFCDFDKVKGLEGIYIANIYDKNHLLSESS
EKNAIKEAKKFQKTVITFDKGGEWKSVLPPERDSEGKRIICDEDCSLHLHSFTSEYSQVY
SNENAIGIILATGNVGRYLSYKEDELNTYLSRDGGFTWKEVKKGGYIYEMGDHGAIIVMA
DSQKATDTIYFSWNEGLTWEKITIDFPLEIENIIIEPTSTSQKFLVFGEKDGKGITVAID
FSSYHEPMCKKPEKAGSPDSDYEIWSPHDLRSSSCLLGRKVEYVRRKQDAECFNGEEFER
PKFIENCSCTDEDFECDLGYYRQETGACQEIEGFIYPELECDENDMMFTVTGYRRVAGDS
CKGGVQSQYEPVKVPCTDTSSSVVFILLALGLTGGSIWGLKNYGGQIKGWISNFSSEKFD
RAGFFSDLSKAPEGMEEEMADTKFEHHEEEFDPRT


>SteCoe_29949(CDS)
ATGGAAAAGCTCTGGCTCATAATACTGATCGCTAGTGCTCTAGCTGTTAACGAAGACAAA
ATCGAGTTCAAACAATTAGAAATCGATTCTGAAATAAGTGAAGTGCTATACTGTGGAGCA
AAAAAAGATACTATCATTATCATTACTGATGAGAAGCAAGCGTATCGATCAGAGAATTCT
GGCTTTTCCTGGAAACAAATCTCGTCAGAAGACAAGACTATGAAAGTTGAAAAGGTTGTT
TTCAGCAAGGCTGACTCAAAACTTGTTGCTTTTCTAGGCAAAGATGGGAAAAACTGGTAC
TCAGAAGATTGTGGTAAGACCTTGAAAACCATAAATCATGGAAATTTGATAGAAGATTTT
AGGTTCCACCCGAAAATGCGTGCGTGGGGCCTTGCTGTATCATGGGCGAAATGCTCTGAG
GTTAGTGAAATTGATTGCTCTAAGACTAGGGTTTTGTATTTAACTAAGGATCTTGGAAGT
ACTTGGAACCCAATTTTAGATTTTGTAGTTCAGTTCAGTTGGGGGCATGATGGGCTTAAT
GATAAAATCACTAAGAATTTACCAATTGAGAGGATTTATGTGACTAGGAATAATAATCCT
TCATCAGACAAGCAGACAGGGTGGAATATCAATGTGGATTTTATGTGCTCAGACGATTTT
TTTAGTTCGAAAAATTTGATGGTCAGATATGGAAATAAGTTTCTGTTGGCTGACAAATTC
ATTTTTGTTGCTGCTGCGGTTGAAGATGACCCTGAAGAAGTTAAGCTTATGGTTGCATCA
GATTCAGATATTGAGAATTTTGTCAAAGCAGAACTTCCTGTGAAAAAAATCCCTGAACAT
AGTTATACTTTATTAGATACAAGTGAAGGCGCTATTTTTCTCCATGCAAATCATTATGGA
ACCAGGTCTAACTATGGGACCATATACATTTCTGATGGTACTGGCAAGAGATTCAGCATA
TCATTGTTGCACAACGTCAGGGAAAAAAAGGGCTTTTGCGATTTTGATAAAGTTAAAGGA
CTTGAAGGGATTTACATAGCAAATATCTACGATAAAAATCATCTACTCAGTGAGTCTTCT
GAAAAAAATGCTATAAAAGAAGCGAAAAAGTTTCAGAAAACTGTTATAACATTTGATAAA
GGTGGGGAATGGAAAAGTGTTTTGCCTCCTGAAAGAGACTCAGAGGGGAAGAGGATTATT
TGTGATGAAGACTGCTCCCTTCATTTACATTCTTTCACTTCTGAATATTCACAAGTATAT
TCTAATGAAAATGCTATTGGTATTATTTTAGCTACTGGGAATGTAGGCCGATATCTTTCT
TACAAAGAAGACGAGCTTAATACTTATCTTTCTCGTGATGGAGGATTTACATGGAAGGAA
GTGAAAAAAGGTGGATACATCTATGAAATGGGTGACCATGGAGCAATCATCGTCATGGCA
GACTCACAAAAAGCTACAGACACTATATACTTTTCATGGAACGAAGGTCTAACATGGGAG
AAAATCACTATTGATTTTCCTCTAGAAATCGAAAATATCATTATTGAGCCAACTTCAACA
TCACAAAAATTTTTAGTTTTCGGTGAAAAAGATGGTAAAGGTATAACAGTTGCTATAGAT
TTCTCATCATATCATGAACCAATGTGCAAAAAGCCAGAAAAAGCTGGGAGCCCAGACAGT
GACTATGAAATATGGAGTCCTCACGATTTAAGATCATCAAGTTGTCTTCTTGGACGTAAG
GTCGAATATGTTAGAAGAAAGCAAGACGCTGAATGTTTTAATGGAGAAGAGTTTGAAAGA
CCAAAATTTATTGAAAACTGCTCATGCACTGATGAGGACTTTGAATGTGATTTAGGGTAC
TATAGACAAGAAACTGGGGCATGCCAAGAAATAGAAGGATTTATATACCCTGAGTTGGAA
TGTGATGAAAATGATATGATGTTTACAGTTACAGGGTATAGAAGAGTAGCTGGAGATTCT
TGTAAAGGAGGCGTGCAATCACAATACGAGCCTGTTAAAGTTCCTTGCACTGATACTTCA
AGTTCAGTAGTTTTCATATTACTAGCTTTAGGTCTTACTGGTGGAAGCATATGGGGACTC
AAAAATTATGGGGGGCAAATCAAAGGCTGGATAAGTAATTTTTCAAGTGAAAAATTCGAT
CGCGCGGGTTTCTTCTCTGATTTAAGCAAAGCTCCTGAAGGCATGGAAGAAGAGATGGCT
GATACAAAATTCGAACATCACGAGGAAGAATTTGATCCTAGGACTTGA