Identifiers and Description

Gene Model Identifier

SteCoe_30033

Standard Name

None

Aliases

None

Description

Ribosomal_L23eN domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Oxytricha TrifallaxContig1434.1.g1232.8625185805493937e-20Ribosomal protein L23

WormBaseWBGene000044392.3195228302435696e-16
Tetrahymena ThermophilaTTHERM_001349400.000000000000001713908431542013Homolog of Yeast RPL25, Human
RPL23A, Bacteria RPL23; Riboso
mal protein L23 containing pro
tein
Saccharomyces CerevisiaeYOL127W0.000000000000004658886145103398Ribosomal 60S subunit protein
L25; primary rRNA-binding ribo
somal protein component of lar
ge ribosomal subunit; binds to
25S rRNA via a conserved C-te
rminal motif; homologous to ma
mmalian ribosomal protein L23A
and bacterial L23

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_30033(Protein)
MAAKAKPDAKKTGKVLKKGLHQRKHKKWTTVRFRRPETKVLPRKPKYARLSVAGKTRLDK
FSTFLQPLATEKALKIIETFNTLVFLVDPKSNKKQIKEFAEKLYNIKVTKVNTLIRPDGK
KKAFIKISPEYEGVDIANKIGII


>SteCoe_30033(CDS)
ATGGCAGCTAAAGCAAAACCTGATGCTAAGAAAACAGGAAAGGTTTTAAAAAAAGGTCTT
CACCAGAGAAAGCACAAAAAATGGACTACTGTGCGTTTCCGCAGACCAGAAACCAAAGTT
TTGCCTAGAAAGCCCAAATACGCCCGTTTAAGTGTTGCAGGGAAAACCCGTCTAGATAAA
TTCTCAACTTTTCTTCAGCCTTTAGCCACTGAAAAGGCTTTAAAAATCATTGAGACTTTC
AACACCCTGGTTTTCTTAGTAGACCCTAAATCAAACAAAAAACAAATCAAAGAGTTTGCA
GAGAAACTTTACAATATAAAAGTAACTAAAGTGAACACTTTGATTAGACCAGATGGGAAA
AAGAAGGCGTTTATCAAAATTTCCCCAGAATATGAAGGTGTTGATATTGCCAATAAGATT
GGAATAATTTAG