Identifiers and Description

Gene Model Identifier

SteCoe_30056

Standard Name

None

Aliases

None

Description

NTP_transf_2 domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Oxytricha TrifallaxContig12798.0.g752.9374821117108028e-30Cid1 family poly A polymerase

Tetrahymena ThermophilaTTHERM_005694207.095474162284704e-23Related to Saccharomyces cerev
isiae noncanonical poly(A) pol
ymerase proteins TRF5 and PAP2
(TRF4)
Saccharomyces CerevisiaeYNL299W5.242885663363464e-22Non-canonical poly(A) polymera
se; involved in nuclear RNA de
gradation as a component of th
e TRAMP complex; catalyzes pol
yadenylation of hypomodified t
RNAs, and snoRNA and rRNA prec
ursors; overlapping but non-re
dundant functions with Pap2p
WormBaseWBGene000141151.5628821893349888e-18

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_30056(Protein)
MDPTFKGKKAEDRHRSRSRTPGKSSPVRDFIPLSSISRPISQLQVAPWVRPHTLKFDDPL
LQLHEEIIDFYDYMQPSEKDNEDRLDVIQRIKTIAQELWPDSQIDVFGSYETGLWLPNSD
IDLVIMTGTDEDLTELINAFAYKICSLGMASEMDRILTAKVPILKMKDRKTGIYLDISFN
LDNGLQGISVVKEYLEKYPEAKYIVCVVKYFLKQRGLNDTYSGGVGSFLLFCLVISSIQQ
HPAHRQDRKYYTRYTLAHYLVSFLKLYGEDFSYEIVGISIKGEGSYFKKASKNWYYNEKP
GYIAVECPQNPENDLGKNSFSIELVKKAFSHAYKLFCAQSKKIALTPLNMIIRVDELIQS
RPPCHR


>SteCoe_30056(CDS)
ATGGACCCAACTTTTAAAGGCAAAAAGGCTGAAGATCGCCACCGCAGCCGTTCAAGAACT
CCTGGTAAAAGCTCCCCAGTAAGAGATTTCATCCCTTTATCTAGTATCTCAAGGCCTATC
TCACAACTCCAAGTGGCCCCCTGGGTCCGACCCCACACATTAAAATTTGACGATCCACTT
CTTCAGCTTCACGAAGAAATAATTGATTTTTACGACTATATGCAGCCATCAGAAAAAGAT
AATGAAGATCGTTTAGATGTTATCCAACGTATAAAAACCATAGCCCAAGAGCTTTGGCCT
GATAGCCAAATCGACGTATTTGGTTCATATGAAACTGGACTTTGGCTTCCAAACAGCGAT
ATTGATTTAGTTATAATGACAGGAACAGATGAAGATTTAACAGAGCTAATAAATGCTTTT
GCTTACAAAATCTGCTCACTTGGCATGGCTAGCGAAATGGATCGTATTCTTACAGCTAAA
GTGCCTATTTTAAAAATGAAAGACAGAAAAACAGGGATTTATCTTGATATAAGCTTTAAT
TTAGACAATGGTTTACAAGGTATTAGCGTTGTTAAAGAATATTTAGAAAAATACCCTGAA
GCTAAGTATATTGTTTGTGTTGTTAAGTATTTTCTTAAACAAAGAGGATTGAATGATACG
TATTCTGGTGGGGTTGGGTCATTTTTATTATTTTGTTTGGTTATAAGCTCAATCCAACAA
CATCCTGCACATAGACAAGATAGGAAGTATTATACGAGATACACACTGGCTCATTATTTG
GTGAGTTTTTTGAAACTTTATGGTGAAGATTTTAGTTATGAAATTGTGGGAATTAGTATA
AAAGGAGAAGGAAGCTATTTTAAAAAAGCTTCAAAGAACTGGTATTATAATGAAAAGCCA
GGATATATAGCGGTGGAATGTCCGCAGAACCCTGAAAATGATCTGGGGAAAAACTCGTTT
TCTATTGAATTGGTGAAAAAAGCATTTTCGCATGCTTATAAACTTTTCTGTGCCCAAAGC
AAAAAAATTGCCTTGACCCCGTTGAATATGATAATTAGAGTTGATGAACTTATACAGTCA
AGACCCCCTTGCCATAGATAA