Identifiers and Description

Gene Model Identifier

SteCoe_30113

Standard Name

None

Aliases

None

Description

ThiF domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Oxytricha TrifallaxContig9991.0.g101.8521167695179754e-45ThiF family

Tetrahymena ThermophilaTTHERM_002159607.47197233734299e-43Subunit of heterodimeric nucle
ar SUMO activating enzyme E1 w
ith Uba2p
WormBaseWBGene000067357.984904245686979e-30
Saccharomyces CerevisiaeYPL003W8.533047625744066e-17Protein that activates Rub1p (
NEDD8) before neddylation; act
s together with Uba3p; may pla
y a role in protein degradatio
n

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_30113(Protein)
MATDNKYDRQLRLWGSEGQHLLNTSRVCMLGSSGLSSESLKNLVLPGIGFFTIVDDTLVT
ERDLGENFFVTQSDLGKPRADVVKTYLLELNPDVQGESLIQSIPSVLSNPSFFQTYSLII
ACQLSFSEIRTLGAICEQNNKKLIVAKSNGLLGYLRIYCKEHLVIESKPSDKEIYDLRLY
EPFPELLAYAESISLDGIQDIYHSHIPFIVLLVKFLKEWTETHGTKPRNMEEKTRFKDFV
KGKSRDFFAQLNFQEAVSKAYLCFLEEKLPSEVMDILNDEKSVNADVNSEDFWICAKAVK
EFMDRNQTVPLSGIFSDMTSDTNSYITLQNIYKNRADCDYIEVLQNYQRIKGTNQEPEIV
RQFCKNLQTLEVTRFRSLESEFLSINAESIDEDEFEESKSLEWYLALRALDWFIQDQNRE
PTQDDKETLIKHTETLGKSIASEIAEEIIRFGKSELHCISAFIGGALSQEAVKLITHQYT
PINNTFLFNSVHTTAVVLNL


>SteCoe_30113(CDS)
ATGGCGACTGACAACAAATACGATCGGCAACTAAGACTTTGGGGTTCAGAAGGTCAGCAT
TTACTAAACACATCTCGTGTATGTATGTTAGGTTCATCTGGCTTAAGTAGTGAATCTCTA
AAAAACCTAGTCCTCCCTGGGATTGGTTTTTTCACTATAGTAGACGATACTTTAGTCACA
GAAAGAGATCTTGGGGAGAATTTCTTTGTAACCCAATCCGACCTTGGAAAGCCTCGAGCT
GATGTAGTTAAGACATATTTACTTGAACTCAATCCAGATGTTCAAGGAGAAAGTTTAATC
CAAAGTATTCCTAGTGTATTATCAAACCCAAGCTTTTTTCAAACTTATTCTTTGATCATA
GCATGTCAGCTTTCTTTCTCAGAAATTAGAACTTTAGGGGCGATATGTGAACAGAATAAT
AAAAAACTTATAGTGGCTAAATCAAATGGGCTTCTTGGATATCTTAGAATATATTGTAAA
GAACATTTGGTAATAGAATCTAAACCTAGTGATAAAGAAATCTATGATTTACGTCTTTAT
GAACCTTTTCCTGAACTTTTAGCTTATGCTGAGAGTATAAGTCTTGATGGGATTCAAGAT
ATTTATCATTCCCATATACCTTTTATAGTCCTTTTAGTCAAGTTTCTTAAGGAATGGACT
GAGACTCATGGGACAAAACCTAGGAATATGGAGGAAAAAACTAGATTTAAAGACTTTGTT
AAAGGAAAAAGCAGGGATTTCTTTGCCCAGTTGAATTTCCAGGAAGCCGTAAGTAAAGCG
TATTTATGCTTTTTAGAAGAAAAACTACCTTCAGAAGTTATGGATATATTAAATGATGAG
AAATCTGTTAATGCTGATGTAAATAGTGAAGATTTTTGGATTTGTGCCAAGGCTGTAAAA
GAGTTTATGGATAGAAACCAAACTGTACCTCTTAGTGGGATTTTTTCTGATATGACATCA
GATACTAATTCTTATATAACTTTACAGAATATTTATAAAAACCGAGCTGATTGTGATTAT
ATTGAAGTCCTTCAAAACTACCAAAGGATTAAAGGAACAAACCAAGAACCAGAAATTGTC
AGGCAGTTCTGTAAAAATCTTCAAACCCTTGAAGTGACGCGTTTTCGTTCTTTAGAGTCT
GAGTTTCTATCAATAAACGCTGAAAGTATCGATGAAGACGAATTTGAAGAATCCAAAAGC
TTAGAATGGTACCTTGCCTTACGTGCTTTAGACTGGTTCATCCAAGATCAAAATCGTGAG
CCAACCCAAGACGACAAAGAAACTCTTATAAAACATACCGAGACCCTAGGAAAATCCATA
GCCTCAGAAATTGCTGAAGAAATCATCCGTTTCGGTAAAAGTGAACTTCATTGTATCAGT
GCTTTTATAGGTGGCGCATTAAGCCAAGAAGCTGTAAAGCTCATAACCCATCAATACACT
CCAATAAACAACACTTTCCTTTTCAATAGTGTTCATACAACCGCCGTAGTGCTAAATCTC
TAG