Identifiers and Description

Gene Model Identifier

SteCoe_30247

Standard Name

None

Aliases

None

Description

Drf_GBD domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Tetrahymena ThermophilaTTHERM_003122406.47023492564546e-26Formin-like protein
WormBaseWBGene000190300.0000000001026187963170189

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_30247(Protein)
MGNKHGPDKRYDYPTAPIDVQRRCSLILAKSEIPLQPAPGTELILQEFTSKLSELNISED
QKEWLLSQPVEIKWQLLCRHIEEQKSAGTKKNRDAQGIISELNKNPSALGIKKVHTWLEA
ASKKSVERFIENGGTENLINIMIVAQELSIRTHNFQRQEEILKCLHVVTDHALGVFDLIY
DESTVGILALNMSELNPIITSMTIKILEKLCWTNTHAYNLVLKALEVHAVEQKFQSRFDF
LIKLLKSENTKSKLASMQLINSLTESPTDENVAQGIRAEFLALNIKTILLDLKASLGSSL
TCSELNRVRTNLTKKKKLAEQREHEEKKDGDFERTRLKTEDVTRDKKERHKAQINTIDPD
EVNITRQRRTVKISAAAPKTVGLSKEGEKALQMFMKTTKEVSSEEESESSDKEAEDESDL
QQILLAQVLLFLENSDQTAEGNPITLLQTIEKNANAAHSFQNFLEILQNLTLIPPDPILG
QNVWMSLLTFSKKITENIAKGIQTTEEFRLDDVMEGQKDLLIKVQKLELLEQNLLARESE
IEKVRREKYDLEEKIKSLKEDLGKNKEVAEVKMKMAKLEYDKIKANEKLEGKKKKIEKFK
NLLEKEKSLNNDLSNQIVELKKNAELKVSYVQQPLMSVATPPPPQISSGNRAPPPPPSNS
VTAPPPPPPNSGNRAPPPPPPSSVTAPPPPPPSSGNKAPPPPPTGSGTAPPPPPPSSGNR
APPPPPPSSGNRAPPPPPPSSGNRAPPPPPPSSGNRAPPPPPPSSGNRAPPPPPPSSGNR
APPPPPPSSGNRAPPPPPPSSGNRAPPPPPPSSGNRAPPPPPPSSGNRAPPPPPPSSGNR
APPPPPPSSGNRAPPPPPPSSGNRAPPPPPPSSGNRAPPPPPPSSGNRAPPPPPPSSGNR
APPPPPPSSGNRAPPPPPPSSGNRAPPPPPPSSGNRAPPPPPPSSGNRAPPPPPPSSGNR
APPPPPPSSGNRAPPPPPPSSGNRAPPPPPPSSGNRAPPPPPPGSVTAPPPPPGSSRAPP
PPPPSGSVTTPPPPPPGTSRAPPPPPPGSNTAPPPPPPGASRPPPPPPPGSNTAPPPPPP
GTSRPPPPPPPGSNTAPPPPPPGTSRPPPPPPPGSNTTPPPPPPGTSRPPPPPPPGSNTA
PPPPPPGTSRPPPPPPPGSNTTPPPPPPGTSRPPPPPPPGSNTAPPPPPPPPGTSRPPPP
PPGSNTAPPPPPPGTSRPPPPPPPGSGTAPPPPPPGSGSGRPPPPPPPGSSTAPPPPPPG
SGRPPPPPPPGSSTAPPPPPGAGRPPPPPPPGSRPPPPPGQGPPAPPMAAFQPPPPAPVP
TKAKITPAVPMKALFWTVIPPSQYQKSIWKSLDDTKVKLNVNDLVTNFCQRKPNEKAPVE
SQPQEVKKIEKICHLSKERKQAVEIVLGKLKLSNSAIIEALITCDRSVLKEGPLISLRVS
IPDEGEHSVISCYEGDIDMLAVPDRFFYMLIKEVPAFKFRIEGMLFTFTNREILGELKGR
VEMVENTLTNIRSNKKLLTILETVLAAGNYLNGTSVRGGAFGFTVDSLSKVIDMRGQDGK
TTLLDYLITYFDSTNPQILSVKNDFPDIEYLSKLPLNQLTVEFNEANLKFIALRKAVESQ
TSRAIDKAKEILNPFYTTIEQVINELKSRIQALDSKFTELCEFYCVNPKDLKFEEFIEKF
SFFLKSFNEVKENYLKAKEEKEKKARIEARKKENASKPKEPQPVIGVNALANAKALADDL
RKRRAEKGNNEKTAPILTVKSTDKMMQAIETRRMTVMPNP


>SteCoe_30247(CDS)
ATGGGTAATAAACACGGACCTGATAAGCGATACGACTATCCAACAGCGCCAATAGACGTG
CAAAGGCGTTGCAGTCTAATCTTAGCCAAGTCTGAAATTCCATTACAGCCAGCTCCAGGT
ACAGAGCTAATCCTCCAAGAGTTCACATCAAAGCTTTCAGAACTAAACATATCAGAAGAT
CAAAAAGAGTGGCTCTTATCCCAGCCAGTTGAAATCAAATGGCAGCTTCTCTGCCGGCAT
ATAGAAGAACAAAAATCAGCAGGGACAAAAAAAAACAGAGATGCTCAAGGAATAATATCA
GAACTAAACAAAAACCCATCAGCCCTTGGGATTAAAAAAGTTCATACCTGGCTTGAGGCT
GCTAGTAAAAAATCAGTAGAAAGGTTTATAGAAAACGGGGGGACTGAAAATCTTATCAAT
ATCATGATTGTAGCCCAAGAATTATCAATACGAACGCATAACTTTCAAAGACAAGAAGAA
ATTCTTAAATGTTTGCATGTTGTAACTGATCATGCATTAGGGGTATTTGATCTTATATAT
GATGAAAGTACTGTAGGAATTCTTGCTTTAAACATGAGTGAACTCAACCCAATAATCACT
AGTATGACTATTAAAATATTAGAAAAACTATGTTGGACTAATACTCATGCATATAATTTA
GTGCTTAAAGCTCTTGAAGTCCATGCGGTTGAGCAGAAATTCCAAAGTAGGTTTGATTTT
CTTATAAAATTATTGAAAAGTGAGAATACTAAAAGCAAACTTGCTTCTATGCAGCTGATA
AACAGTCTTACTGAAAGCCCAACTGATGAAAATGTTGCCCAAGGGATTAGAGCTGAATTC
TTAGCTTTAAATATTAAAACTATACTTCTTGACTTAAAAGCTAGCCTTGGAAGTTCACTT
ACTTGTTCAGAATTAAATAGAGTTAGGACTAATCTGACTAAGAAAAAAAAATTAGCTGAA
CAAAGGGAACATGAAGAGAAAAAAGATGGGGATTTTGAAAGGACTAGACTTAAAACTGAA
GATGTGACTAGGGATAAAAAAGAAAGACATAAAGCACAGATTAATACTATTGATCCTGAT
GAAGTTAATATTACTAGACAAAGAAGGACTGTTAAAATAAGTGCTGCTGCTCCAAAAACT
GTTGGGTTAAGTAAAGAAGGAGAAAAAGCTTTACAGATGTTTATGAAAACTACAAAAGAA
GTATCTAGTGAAGAAGAGTCTGAAAGTTCTGATAAAGAAGCTGAGGATGAAAGTGATCTT
CAACAAATACTTTTAGCTCAAGTTTTATTGTTTTTAGAAAATAGTGATCAAACTGCTGAA
GGGAATCCTATAACTTTATTACAAACTATAGAAAAAAATGCTAATGCCGCTCATAGTTTC
CAGAATTTCTTAGAAATACTTCAAAACCTTACGTTAATACCCCCTGACCCTATACTTGGC
CAAAATGTGTGGATGTCTCTATTGACTTTTTCTAAGAAAATCACTGAGAATATTGCTAAA
GGAATACAAACTACTGAAGAGTTTAGGCTTGATGATGTTATGGAAGGGCAGAAGGATTTA
TTAATAAAAGTACAGAAATTGGAATTACTTGAACAGAATTTACTTGCAAGGGAATCGGAA
ATAGAAAAAGTTAGGAGGGAAAAATATGATTTGGAAGAGAAAATTAAAAGCCTTAAAGAA
GACTTGGGGAAAAATAAAGAAGTGGCTGAGGTGAAAATGAAAATGGCGAAATTGGAGTAT
GATAAAATAAAAGCAAATGAAAAATTAGAGGGGAAGAAAAAGAAAATCGAGAAATTTAAG
AATTTATTAGAGAAGGAGAAAAGTTTGAATAATGATTTGAGTAACCAGATTGTGGAGTTG
AAGAAAAATGCTGAATTGAAGGTTTCATATGTACAACAACCTCTTATGTCAGTTGCAACT
CCACCTCCTCCACAAATTAGTTCAGGAAATAGAGCTCCTCCTCCTCCACCATCAAATTCG
GTAACTGCACCACCTCCTCCTCCCCCTAATTCAGGAAATAGAGCTCCTCCTCCACCACCA
CCAAGTTCAGTAACTGCACCACCTCCTCCTCCTCCTAGTTCAGGAAATAAAGCTCCTCCT
CCTCCACCTACAGGATCAGGTACAGCCCCTCCACCTCCTCCTCCAAGTTCAGGCAATAGA
GCACCTCCCCCACCTCCTCCAAGTTCAGGCAATAGAGCACCTCCCCCACCTCCTCCAAGT
TCAGGCAATAGAGCACCTCCCCCACCTCCTCCAAGTTCAGGCAATAGAGCACCTCCCCCA
CCTCCTCCAAGTTCAGGCAATAGAGCACCTCCCCCACCTCCTCCAAGTTCAGGCAATAGA
GCACCTCCCCCACCTCCTCCAAGTTCAGGCAATAGAGCACCTCCCCCACCTCCTCCAAGT
TCAGGCAATAGAGCACCTCCCCCACCTCCTCCAAGTTCAGGCAATAGAGCACCTCCCCCA
CCTCCTCCAAGTTCAGGCAATAGAGCACCTCCCCCACCTCCTCCAAGTTCAGGCAATAGA
GCACCTCCCCCACCTCCTCCAAGTTCAGGCAATAGAGCACCTCCCCCACCTCCTCCAAGT
TCAGGCAATAGAGCACCTCCCCCACCTCCTCCAAGTTCAGGCAATAGAGCACCTCCCCCA
CCTCCTCCAAGTTCAGGCAATAGAGCACCTCCCCCACCTCCTCCAAGTTCAGGCAATAGA
GCACCTCCCCCACCTCCTCCAAGTTCAGGCAATAGAGCACCTCCCCCACCTCCTCCAAGT
TCAGGCAATAGAGCACCTCCCCCACCTCCTCCAAGTTCAGGCAATAGAGCACCTCCCCCA
CCTCCTCCAAGTTCAGGCAATAGAGCACCTCCCCCACCTCCTCCAAGTTCAGGCAATAGA
GCACCTCCCCCACCTCCTCCAAGTTCAGGCAATAGAGCACCTCCCCCACCTCCTCCAAGT
TCAGGCAATAGAGCACCTCCCCCACCTCCTCCAAGTTCAGGCAATAGAGCACCTCCCCCA
CCTCCTCCAGGATCAGTAACAGCACCACCTCCACCTCCAGGATCATCAAGAGCTCCTCCA
CCACCACCTCCTTCAGGTTCAGTAACAACTCCTCCACCTCCTCCTCCAGGAACATCAAGA
GCACCTCCACCACCTCCTCCAGGTTCAAATACAGCTCCACCACCTCCACCTCCAGGAGCA
TCAAGACCTCCACCACCTCCTCCTCCAGGTTCAAATACAGCTCCACCACCTCCACCTCCA
GGAACATCAAGACCTCCACCACCTCCTCCTCCAGGTTCAAATACAGCTCCACCACCTCCA
CCTCCAGGAACATCAAGACCTCCACCTCCTCCTCCTCCAGGTTCAAATACAACTCCACCA
CCTCCACCTCCAGGAACATCAAGACCTCCACCACCTCCTCCTCCAGGTTCAAATACAGCT
CCACCACCTCCACCTCCAGGAACATCAAGACCTCCACCTCCTCCTCCTCCAGGTTCAAAT
ACAACTCCACCACCTCCACCTCCAGGAACATCAAGACCTCCACCTCCTCCTCCTCCAGGT
TCAAATACAGCTCCACCACCACCACCTCCACCTCCAGGAACATCAAGACCTCCACCTCCT
CCTCCAGGTTCAAATACAGCTCCACCACCTCCACCTCCAGGAACATCAAGACCTCCACCA
CCTCCTCCTCCAGGTTCAGGAACAGCTCCACCACCTCCACCTCCAGGATCAGGATCAGGA
AGACCTCCACCACCTCCTCCACCAGGTTCAAGTACAGCTCCACCACCTCCACCTCCAGGA
TCAGGAAGACCTCCACCACCTCCTCCTCCAGGTTCAAGTACAGCTCCACCTCCACCTCCA
GGAGCAGGAAGACCTCCACCACCACCTCCTCCAGGATCAAGACCTCCACCTCCACCAGGA
CAAGGGCCTCCAGCACCACCTATGGCAGCATTTCAGCCACCTCCTCCAGCCCCAGTACCA
ACAAAAGCTAAAATAACACCAGCAGTACCAATGAAAGCTCTTTTCTGGACAGTTATTCCT
CCAAGTCAATACCAAAAATCTATATGGAAAAGTTTAGATGATACAAAAGTTAAACTTAAC
GTCAATGATCTTGTGACAAATTTCTGCCAACGTAAACCTAATGAAAAAGCTCCAGTTGAA
AGTCAGCCTCAAGAAGTAAAAAAAATAGAAAAAATCTGTCATTTATCTAAAGAACGTAAA
CAAGCTGTAGAAATTGTCTTAGGTAAACTTAAACTATCTAATTCCGCAATAATTGAAGCA
TTAATTACTTGTGATCGTTCAGTACTAAAAGAAGGTCCACTTATATCATTAAGAGTTTCA
ATACCAGATGAAGGAGAACATAGTGTTATAAGTTGTTATGAAGGAGATATCGATATGCTC
GCAGTACCAGATAGATTCTTTTATATGTTAATCAAAGAAGTTCCAGCTTTTAAATTCCGT
ATTGAAGGCATGTTATTTACATTTACAAACAGAGAAATCCTTGGTGAACTCAAAGGACGT
GTTGAAATGGTTGAAAATACCCTAACAAATATTCGTTCTAATAAAAAACTTTTGACTATT
CTTGAAACAGTTTTAGCTGCTGGAAATTATCTTAATGGCACAAGCGTTAGAGGGGGGGCT
TTTGGATTTACTGTTGATTCTTTAAGTAAAGTTATTGATATGAGAGGACAAGATGGGAAA
ACAACTTTACTTGACTATCTTATAACATACTTTGATTCTACAAACCCACAAATTCTTAGT
GTTAAAAATGATTTTCCTGATATTGAATATCTATCAAAACTTCCATTAAACCAATTAACT
GTTGAATTTAATGAAGCTAATCTGAAATTCATAGCATTACGTAAAGCTGTAGAATCACAA
ACATCAAGGGCTATTGACAAAGCTAAAGAAATCCTTAATCCATTTTATACAACAATAGAG
CAAGTTATCAATGAACTAAAATCACGAATCCAAGCCTTGGATTCGAAATTCACTGAGCTT
TGTGAGTTTTATTGTGTGAATCCTAAAGACTTAAAATTCGAAGAGTTTATTGAAAAGTTC
TCTTTTTTCTTAAAATCTTTTAATGAAGTTAAAGAAAACTACCTTAAAGCTAAAGAAGAA
AAAGAGAAAAAAGCTCGTATTGAAGCTAGGAAAAAGGAAAATGCTAGTAAACCTAAAGAA
CCACAGCCTGTTATTGGAGTTAATGCTTTAGCTAATGCCAAAGCTCTTGCTGATGATTTA
AGAAAACGCCGAGCTGAGAAAGGGAATAATGAAAAAACAGCACCGATATTGACTGTCAAA
TCTACTGATAAAATGATGCAAGCTATTGAAACTAGGAGAATGACGGTTATGCCAAACCCA
TAA