Identifiers and Description

Gene Model Identifier

SteCoe_30353

Standard Name

None

Aliases

None

Description

Vps26 domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
WormBaseWBGene000069312.2856936767186716e-49
Oxytricha TrifallaxContig20025.0.g871.8521167695179754e-45Vacuolar protein sorting-assoc
iated protein 26

Tetrahymena ThermophilaTTHERM_011240001.2160992992528256e-37VPS; Vacuolar protein sorting-
associated protein; retromer s
ubunit
Saccharomyces CerevisiaeYJL053W1.185064864233981e-27Vacuolar protein component of
the retromer; forms part of th
e multimeric membrane-associat
ed retromer complex involved i
n vacuolar protein sorting alo
ng with Vps35p, Vps29p, Vps17p
, and Vps5p; essential for end
osome-to-Golgi retrograde prot
ein transport; interacts with
Ypt7p; protein abundance incre
ases in response to DNA replic
ation stress

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_30353(Protein)
MFGAKGEISLELEGLEQRKKVPFKDASGKEVQLPVYSADEDIVGKVNVVLKKGKKLEHQG
IKIELYGRIDITYEKNQTSDFISLSRELEPPGAITQNISIPFSFNKVEKSYETYTGRYCK
LRYFIKVTMARKVSSNMTKEIEFAVLNTQSEVEENTPIKMEVGIEECLHIEFEYNRQKYH
LKDCIIGKVYFLLVRIRIKYMELAIIRRETIGAGAQATNENETIAKYEVMDGAPVRGENI
PIRMFLGAFELTPTYYNVNNKFSVRHFLNLVLVDEEDRRYFKQQEIILWRKEL


>SteCoe_30353(CDS)
ATGTTCGGGGCAAAAGGAGAGATATCATTAGAACTAGAAGGTTTAGAACAAAGAAAAAAG
GTGCCTTTCAAAGATGCAAGTGGTAAAGAAGTCCAGCTTCCTGTTTACTCTGCTGATGAA
GATATTGTTGGGAAAGTCAATGTTGTATTAAAGAAAGGTAAAAAACTCGAGCATCAAGGT
ATTAAAATAGAGTTGTATGGGAGAATTGATATCACATACGAGAAAAATCAGACAAGCGAC
TTTATTTCTCTCTCCAGAGAACTAGAGCCTCCTGGAGCTATAACCCAGAACATTTCAATA
CCTTTCTCGTTCAATAAGGTTGAGAAATCTTATGAAACATACACTGGCCGCTATTGCAAA
TTGAGATACTTCATCAAAGTGACCATGGCTCGCAAGGTATCAAGTAACATGACAAAAGAA
ATTGAATTTGCAGTACTCAACACCCAAAGTGAAGTTGAAGAAAATACGCCAATCAAAATG
GAAGTTGGTATTGAAGAATGTCTTCATATTGAATTCGAATACAACAGACAAAAGTATCAT
CTTAAAGACTGCATAATAGGCAAAGTGTACTTTTTATTAGTCCGCATTCGTATAAAATAT
ATGGAATTAGCCATAATACGTCGTGAAACTATAGGCGCAGGAGCACAAGCAACTAATGAA
AATGAAACAATAGCCAAATATGAAGTTATGGATGGTGCACCTGTACGTGGAGAAAATATT
CCAATTCGTATGTTTTTAGGTGCTTTTGAATTAACTCCTACATATTACAATGTCAATAAC
AAGTTTTCAGTCAGACATTTCCTTAATTTAGTTTTAGTTGATGAGGAAGATAGGAGATAT
TTCAAGCAACAAGAGATTATACTTTGGAGAAAAGAATTATAG