Identifiers and Description

Gene Model Identifier

SteCoe_30356

Standard Name

None

Aliases

None

Description

ATP-synt_C domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

Cellular Component

  • proton-transporting two-sector ATPase complex, proton-transporting domain (IEA) | GO:0033177

Molecular Function

  • hydrogen ion transmembrane transporter activity (IEA) | GO:0015078

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Oxytricha TrifallaxContig5607.0.g532.6786369618080778e-33ATP synthase subunit C

Tetrahymena ThermophilaTTHERM_002183303.975449735908647e-31ATP synthase subunit C family
protein
WormBaseWBGene000069131.2995814250075031e-24
Saccharomyces CerevisiaeYHR026W1.0530617357553812e-20Subunit c'' of the vacuolar AT
Pase; v-ATPase functions in ac
idification of the vacuole; on
e of three proteolipid subunit
s of the V0 domain

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_30356(Protein)
MSTCSSCQNEACWNDCTSTTWAEILSALSPYSWAYIGLGLALGLSIIGAAWGIFLTGSSL
VGAAVKAPRIKSKNLISVIFCEAVAIYGVIIAIILEGKISELKDGDWSSADKINEALYAA
FSVFGAGLSVGFSNLACGIAVGITGSGCALSDAMLPETFVKILIIEIFGSAIGLFGVIVG
IIQVGNNSFPS


>SteCoe_30356(CDS)
ATGTCTACTTGTAGTTCATGTCAAAATGAAGCATGCTGGAATGATTGTACTTCAACCACT
TGGGCAGAAATACTAAGTGCCTTAAGTCCTTATTCATGGGCTTACATAGGTTTAGGACTA
GCCTTAGGTCTTTCAATTATCGGTGCAGCTTGGGGTATTTTCCTCACAGGTTCTTCCTTA
GTAGGTGCAGCAGTCAAAGCACCAAGAATTAAGTCAAAAAACTTAATCTCAGTCATTTTT
TGTGAAGCTGTAGCAATCTATGGAGTAATCATAGCAATTATTCTCGAAGGTAAAATCTCA
GAATTAAAAGATGGGGACTGGTCAAGTGCAGACAAAATAAACGAAGCCCTTTATGCTGCT
TTTTCTGTCTTTGGAGCTGGACTTTCTGTAGGTTTTAGTAACCTCGCATGTGGAATTGCT
GTTGGGATTACAGGAAGTGGATGTGCTCTTTCTGATGCTATGTTACCTGAAACTTTCGTC
AAGATACTAATCATTGAAATTTTTGGCTCTGCTATTGGACTTTTTGGGGTTATTGTAGGA
ATCATACAAGTCGGCAATAATAGTTTCCCTAGTTAA