Identifiers and Description

Gene Model Identifier

SteCoe_30380

Standard Name

None

Aliases

None

Description

GST_N_3 domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Tetrahymena ThermophilaTTHERM_0001614597.095474162284704e-23glutathione S-transferase amin
e-terminal domain protein
Oxytricha TrifallaxContig3600.0.g611.5628821893349888e-18Glutathione S-transferase, C-t
erminal domain

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_30380(Protein)
MEQVVIYADYMSQPSRAVLTYCEIAKIPYKFHEIRVINGDTFTEEFSKISPSQSVPTMIH
GNLVLYESNAILTYLISSFHISDNWYPNDKIKRALVNNYLHWHHMNIRFGCGIYLFNKTI
GPKLFGIVMKDIENLSNEKREEGFQVLENILERYHYVAETEEVSIADIVCYCEIIQMMLV
KVDLKKYPKLENWLERIGRIPEVEKTHRIFFKLLPRFKL


>SteCoe_30380(CDS)
ATGGAACAAGTAGTAATCTATGCAGATTATATGTCTCAACCTTCACGTGCAGTTCTAACC
TACTGCGAAATTGCCAAAATTCCTTATAAATTCCATGAAATTCGAGTAATCAATGGAGAC
ACCTTTACCGAAGAATTCAGTAAAATCTCTCCAAGCCAATCAGTTCCAACAATGATCCAT
GGAAACCTTGTTTTATATGAATCAAATGCTATCCTAACTTATCTTATATCATCATTTCAT
ATATCAGACAATTGGTATCCAAATGATAAAATTAAAAGAGCTTTAGTTAATAATTACCTT
CATTGGCATCATATGAATATCAGATTTGGATGTGGGATTTATCTTTTTAATAAAACAATT
GGGCCTAAGTTATTTGGTATTGTTATGAAAGATATTGAGAATCTTAGTAATGAGAAAAGA
GAAGAAGGTTTTCAAGTATTAGAGAATATTTTAGAAAGATATCATTATGTTGCTGAGACT
GAAGAAGTGTCAATTGCTGATATTGTTTGTTATTGTGAGATTATTCAAATGATGCTTGTT
AAGGTTGATTTGAAAAAATACCCTAAATTAGAGAATTGGCTTGAGAGGATAGGTAGGATT
CCTGAAGTTGAAAAAACTCATAGAATATTTTTCAAACTTTTACCTAGATTTAAACTTTAA