Identifiers and Description

Gene Model Identifier

SteCoe_30427

Standard Name

None

Aliases

None

Description

BING4CT domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Tetrahymena ThermophilaTTHERM_001906204.2960271311739114e-61Nucleolar protein, component o
f the small subunit (SSU) proc
essome containing the U3 snoRN
A that is involved in processi
ng of pre-18S rRNA
Oxytricha TrifallaxContig13443.0.g1031.0377033238158346e-53BING4CT (NUC141) domain

Saccharomyces CerevisiaeYER082C8.408597124803643e-50Nucleolar protein; component o
f the small subunit (SSU) proc
essome containing the U3 snoRN
A that is involved in processi
ng of pre-18S rRNA
WormBaseWBGene000092111.2160992992528256e-37

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_30427(Protein)
MDKRLAARLKAAHGYYHEDKAQNSQSQVLLTQSNGYLEAEGDEKTSKINQKQLKDLVPNY
NSSRMFDLKMSFGGYYVDYTKNGSFLLLAGQQGHISLLKWRNAKLLTEFHTKELIKDVKF
LQNELLFAVAQRKAIHIYDSQGIEVHHLRNHIEPQKLEYLPYHFLLVSANNHGFMKYLDI
STGKPVIEHRFHFENVNDMKQNPWNSLIGIADARGIVTMWSPNINKPVIKLIAHNGPCTQ
LSIDMRGLYMTTTGTDNKLKIYDIRNLGESLYEYWTDYPCNSMSISQTGLLAVAELSKVK
VWKDWQVSKQKAPYMTHMSNSPIVDQQFVPFEDFLGLGCKSGFSNLCVPGSGIANFDTFE
ANPFENSRQRQEHEVRALLDKLPPDTIVVNPHEIGTIDKAEPAVIEAEVKHEKEEREKLA
KEQKAKKRKHKEEKVKNLSVHDKKMREKIQDSHLEKSKQKTELNLKAAKDISFLMDATSD
LLGLPTKKPKYFDI


>SteCoe_30427(CDS)
ATGGACAAAAGACTAGCTGCTCGTCTCAAAGCTGCTCATGGATATTATCATGAGGACAAA
GCTCAGAACTCACAATCTCAAGTTCTGCTAACTCAGTCCAATGGCTATCTAGAAGCAGAA
GGAGATGAAAAGACTTCAAAGATCAATCAAAAACAATTGAAAGATTTAGTCCCAAATTAC
AATTCATCACGTATGTTTGACCTTAAAATGTCTTTCGGTGGCTATTATGTTGACTATACA
AAAAATGGTTCCTTCCTTCTTCTTGCTGGCCAACAAGGTCATATTTCCCTTCTCAAATGG
CGCAACGCAAAACTCTTAACAGAATTCCACACAAAAGAGCTTATAAAAGATGTAAAATTC
CTTCAAAATGAACTCCTCTTCGCTGTAGCTCAAAGAAAAGCTATACATATATACGATAGT
CAAGGAATTGAAGTCCATCATTTACGTAATCATATAGAACCCCAAAAACTCGAATACCTC
CCTTACCATTTTCTTTTAGTCTCAGCAAATAATCATGGTTTTATGAAATATTTAGACATA
TCTACAGGTAAACCAGTAATCGAACATAGATTTCATTTCGAAAATGTTAATGATATGAAA
CAAAACCCATGGAATTCATTAATAGGAATAGCTGATGCTAGAGGAATAGTAACAATGTGG
TCACCTAATATCAATAAACCAGTCATAAAACTTATAGCTCATAATGGTCCTTGTACACAA
TTGTCTATAGATATGAGAGGTTTATATATGACAACAACAGGTACAGATAATAAGCTTAAA
ATTTATGATATTAGGAATCTTGGAGAATCATTATATGAATATTGGACTGATTATCCTTGT
AATAGTATGAGTATTAGTCAAACTGGACTTTTAGCTGTAGCTGAGTTGAGTAAAGTTAAA
GTGTGGAAGGATTGGCAAGTTTCTAAACAAAAAGCTCCTTATATGACACATATGAGTAAT
AGTCCTATTGTTGATCAACAGTTTGTCCCATTTGAAGACTTTTTAGGACTTGGGTGTAAG
TCAGGGTTTTCTAATTTGTGTGTACCAGGCAGTGGTATTGCTAATTTTGATACTTTTGAA
GCTAATCCTTTTGAAAACTCAAGGCAGAGACAGGAACATGAAGTTAGAGCTTTACTTGAT
AAATTACCCCCTGATACTATTGTTGTTAATCCACATGAAATTGGGACTATAGATAAAGCT
GAACCAGCGGTTATTGAAGCTGAAGTTAAACATGAAAAAGAAGAACGTGAAAAACTTGCT
AAGGAACAAAAAGCTAAAAAACGCAAACACAAGGAAGAAAAAGTTAAGAACTTGTCAGTA
CACGATAAGAAAATGAGGGAAAAAATCCAAGACTCTCATTTAGAAAAGTCTAAACAGAAG
ACTGAATTGAACCTAAAAGCTGCTAAAGATATATCTTTTCTTATGGATGCTACATCTGAT
CTTCTAGGACTCCCAACAAAAAAACCTAAGTATTTTGACATATAG