Identifiers and Description

Gene Model Identifier

SteCoe_30428

Standard Name

None

Aliases

None

Description

DNA_pol_B_exo1 domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Oxytricha TrifallaxContig17557.0.g860DNA polymerase family B

WormBaseWBGene000086450

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_30428(Protein)
MQTDIDYYLGESLITKGTNAAILRIYGVTEDGHSVMAHVHGFEPYFWVEDLSKNNPKFLC
GKIIERLNSNPNCREMITKVEFHKKKNIMNFTNDPPQNYYKIFTNVPKSVATVRSSIDKA
QAIYDITGSSTTFESNVPFALRFMIDTGIVGMGWIEIPPEKIQIRDPGYKKSTLQIEVDV
YYKDIIVHKPEGEWSKIPPLRVLSFDIEVNNDGISFPTPDRNEVIQIGNICKIPGDDQAL
SKAIFTLGQCGDIADADVKCYVNESQMLRAWREYVINLDPDIITGYNILNFDYNYLFKRA
EKLNVKDFPYFGRIRNSLTRIKDTTFQSKAQGLRETKEVAMEGRIQLDMFQHIQREHKLS
HYSLNSVSLTFLKEQKEDVHWTTLKDLQEGNDDTRRRIAVYCLKDCYLPLRLLEKLMCLY
NYSEMARVTGVPFSFLLTRGQQIKVASQLMRKAQSCDMLIPTLSKADIGDKYEGAFVLEP
KRNFYNIPIATLDFASLYPSIMMAHNLCYCTLIKPENKKNFNPEDYTLTPTGEAFIKAHV
FKGLLPQILEELIQARKRAREELKNTTDPFMKKVLDGRQLALKISANSVYGFTGAQVGQL
PCLQISSSVTSYGRLMIEETKNEVENHYSIQNGYPNDSVVVYGDTDSVMINFGIDDLTQV
MNLGREAAAHVTKKFINPIKLEFEKVYFPYLLLNKKRYAGLLWTNPNKYDKIDMKGIESV
RRDNCELVRETINTCLHKLLIERNLDETIVYVKNVVSALLQNKIDLSLLVITKALGKKQK
EEGKANKNTYTAKQAHVELANKMQQRDAANAPNVGDRVAYVMIKGTKGQKAYELAEDPIY
ALKNDLPIDFDYYLEKQLKAPLMRLFEDVLPNAQSLFNGEHTRKRYQPKVTTGAMSKFIQ
ITNTCIGCKTSLKTGYLCQGCIKNAPAIYMEKVITSTNAERNFQELWAECQRCQGSICQE
VLCTNKDCPIFYRREKVKKEMDYVKGELDKLALIW


>SteCoe_30428(CDS)
ATGCAGACTGATATAGACTATTATCTAGGTGAAAGTTTAATAACAAAAGGGACAAATGCA
GCAATACTTAGAATATATGGGGTTACTGAAGATGGACATTCAGTAATGGCTCATGTTCAT
GGATTTGAGCCTTATTTCTGGGTTGAAGATCTAAGTAAAAATAACCCAAAATTCTTATGT
GGAAAAATTATAGAAAGACTCAACAGCAATCCTAATTGCCGAGAAATGATAACAAAAGTT
GAATTCCATAAAAAAAAAAACATAATGAATTTCACAAATGATCCACCACAGAATTATTAT
AAAATATTTACTAATGTCCCAAAAAGTGTAGCAACTGTTAGATCTTCTATAGATAAAGCT
CAGGCTATTTATGATATAACTGGATCATCGACAACTTTTGAGTCTAATGTTCCTTTTGCT
TTAAGATTTATGATAGACACTGGCATTGTTGGAATGGGATGGATTGAAATTCCTCCTGAG
AAAATACAAATCCGAGATCCTGGTTATAAAAAATCAACATTACAGATAGAAGTAGATGTT
TATTATAAAGATATTATTGTTCATAAACCTGAAGGAGAATGGTCTAAAATTCCCCCTTTA
AGAGTATTGAGTTTTGATATTGAAGTGAATAATGATGGAATAAGTTTTCCAACACCTGAT
AGAAATGAGGTTATACAAATAGGGAATATTTGTAAAATACCTGGAGATGATCAAGCTTTA
TCAAAAGCAATTTTTACTTTAGGACAATGTGGGGATATTGCTGATGCTGATGTGAAATGC
TATGTAAATGAATCACAAATGCTTAGAGCGTGGAGGGAATATGTGATAAATTTAGACCCT
GATATTATTACTGGGTATAATATTTTGAATTTTGATTATAATTATTTGTTTAAAAGAGCT
GAAAAATTGAATGTAAAAGACTTCCCTTATTTTGGAAGGATTAGAAATAGTCTGACTAGG
ATTAAAGATACTACTTTCCAGTCTAAAGCTCAAGGGTTAAGAGAGACTAAAGAAGTAGCA
ATGGAAGGAAGGATTCAATTGGACATGTTTCAGCATATACAAAGGGAACATAAACTTAGT
CATTATTCCCTTAATTCAGTATCCCTAACTTTCCTCAAAGAACAAAAAGAAGATGTTCAC
TGGACAACTCTCAAAGATCTTCAAGAAGGTAATGATGATACAAGAAGAAGAATTGCAGTT
TACTGTCTTAAAGACTGTTATTTACCATTACGTCTTTTAGAAAAACTCATGTGTTTATAT
AACTACTCAGAAATGGCCCGTGTAACGGGCGTACCATTTTCTTTCCTTTTAACCCGTGGT
CAGCAAATTAAAGTAGCATCACAACTAATGAGAAAAGCACAAAGTTGTGACATGCTTATT
CCAACTTTATCTAAAGCTGATATTGGTGACAAATACGAAGGGGCTTTTGTATTAGAGCCA
AAAAGGAATTTCTATAATATTCCAATCGCTACATTAGATTTTGCATCTTTATATCCATCT
ATTATGATGGCACATAATTTATGTTACTGCACTTTAATTAAACCAGAAAATAAAAAAAAT
TTCAACCCTGAGGACTATACATTAACTCCAACAGGAGAAGCTTTTATAAAAGCACATGTT
TTTAAAGGACTCCTACCACAAATTCTTGAGGAATTAATTCAAGCACGTAAACGGGCAAGG
GAGGAATTAAAAAACACAACTGATCCTTTTATGAAAAAAGTCCTTGATGGACGACAATTA
GCTTTGAAAATCTCTGCAAATTCTGTTTATGGGTTTACTGGAGCCCAAGTAGGTCAACTT
CCTTGTTTACAAATATCATCAAGTGTTACTTCATATGGAAGGTTAATGATTGAAGAAACA
AAAAATGAAGTTGAAAACCATTATTCAATACAAAATGGTTATCCAAATGATTCTGTTGTT
GTTTATGGGGATACAGATTCAGTTATGATAAATTTTGGTATTGATGATTTAACTCAGGTT
ATGAATTTAGGAAGAGAAGCTGCAGCTCATGTGACGAAGAAATTTATAAACCCAATAAAA
TTAGAGTTTGAAAAAGTTTATTTTCCTTATTTGTTACTGAATAAAAAAAGATATGCTGGG
TTATTATGGACGAATCCTAATAAATATGATAAAATTGATATGAAAGGTATTGAAAGTGTG
AGAAGAGATAATTGTGAATTGGTTAGAGAGACTATTAATACCTGTTTACACAAACTTTTA
ATAGAAAGGAATTTAGATGAGACTATAGTTTATGTTAAAAATGTAGTCAGCGCATTATTG
CAAAACAAAATCGATTTGAGTTTATTAGTTATAACAAAGGCTTTAGGGAAAAAACAGAAA
GAAGAAGGAAAAGCTAATAAAAATACATATACTGCTAAACAAGCACATGTTGAATTAGCT
AATAAAATGCAACAAAGAGATGCGGCAAATGCTCCAAATGTTGGTGACCGTGTAGCTTAT
GTTATGATCAAAGGAACTAAAGGCCAAAAAGCTTATGAACTAGCTGAAGACCCTATTTAT
GCATTGAAAAACGATTTACCAATAGATTTTGATTATTATCTAGAAAAACAACTCAAAGCT
CCATTAATGCGTCTTTTTGAAGATGTTTTACCAAACGCACAAAGTTTATTCAATGGTGAA
CATACAAGAAAAAGATATCAGCCTAAAGTTACAACAGGTGCTATGTCAAAATTCATCCAA
ATCACAAATACATGCATAGGATGTAAAACTTCTTTAAAAACTGGGTATCTTTGTCAAGGG
TGTATAAAAAATGCTCCAGCTATTTATATGGAAAAAGTTATAACATCAACAAATGCTGAA
AGAAATTTCCAAGAACTTTGGGCTGAATGTCAAAGATGTCAAGGGTCGATATGTCAAGAA
GTTTTATGTACAAATAAGGATTGTCCGATTTTTTATAGAAGAGAAAAGGTTAAGAAAGAA
ATGGATTATGTAAAAGGTGAACTTGATAAACTGGCTTTGATATGGTAG