Identifiers and Description

Gene Model Identifier

SteCoe_30448

Standard Name

None

Aliases

None

Description

Na_Ca_ex domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

Cellular Component

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Tetrahymena ThermophilaTTHERM_002192604.780892883885469e-25Sodium/calcium exchanger prote
in
WormBaseWBGene000035711.5628821893349888e-18
Oxytricha TrifallaxContig21787.0.g1130.0000000000006914400106940203Sodium/calcium exchanger prote
in

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_30448(Protein)
MSVETLECASVFDDNNRCAYAENYCDPFYVFYFCTFDEHPAFYILIFLLFVYLIYLLGST
ADLYFSPALASLSDTLKLSPTVAGVTLLAFGNGAPDVFSSILAAKKLKVSLSIGALFGGA
IFVSTVVLGRVSLVGSCQMEIKKTLRDCCLLFITALLIMLYGFLGTITMFQACLFPLLYI
FYVFIVFRMEKSQEKLLQNSFELPIMETNFIDWGEIIENYIEKQPQKKYVQVGNRNDFEW
SMIKQKIFIEENQTEFADMGIIMKILFIILYPVNFLRELTIPFYTKENWSRMKASFFPIS
AGIFIIYTQDLFYVQIYNFPLWIFIVFTSIFLGIMIFCTSKRTVLPSYNGKLKALSFFIS
VLWICTICEIMIDLLALTGTLLGLPISFLGLSLLAWGNSAGDFWANPAIARLGMGQTAIT
ACFAGPLFNTLIGFGVSMIVGCTQSKLTFHILNHKELLIAGAFLLVSSAITGVFLIRNTG
KIVRNHGLFQICIYLVFSASLLAYTFL


>SteCoe_30448(CDS)
ATGTCGGTAGAAACTTTAGAGTGTGCTAGTGTTTTTGATGATAATAATCGATGTGCATAT
GCAGAAAATTACTGTGACCCATTTTATGTGTTTTATTTTTGCACTTTTGATGAACACCCA
GCTTTTTATATACTCATTTTCTTGCTGTTTGTATATCTTATTTACTTACTAGGGTCAACT
GCAGACTTGTATTTTTCTCCAGCACTAGCATCATTATCAGATACTCTAAAACTATCTCCC
ACAGTAGCTGGAGTAACCTTATTAGCCTTTGGCAACGGAGCTCCTGATGTTTTTTCTTCA
ATCCTCGCAGCTAAAAAGCTCAAAGTTTCCTTATCAATCGGGGCTTTGTTCGGAGGGGCA
ATATTCGTAAGTACTGTTGTCTTAGGAAGAGTATCTCTTGTCGGGTCCTGTCAGATGGAA
ATAAAAAAAACTTTACGCGATTGCTGTTTACTCTTCATTACAGCCCTTCTTATCATGCTC
TATGGCTTTTTAGGGACAATCACAATGTTTCAAGCTTGTTTATTCCCATTACTTTACATC
TTTTACGTCTTCATAGTCTTTAGAATGGAAAAATCTCAAGAAAAACTCCTACAAAACTCT
TTCGAACTTCCAATCATGGAAACAAATTTCATTGACTGGGGTGAAATCATTGAAAACTAT
ATAGAAAAACAACCACAAAAAAAATATGTTCAAGTAGGGAATAGAAATGATTTTGAATGG
AGTATGATAAAACAGAAAATCTTTATAGAAGAAAATCAGACTGAGTTTGCTGATATGGGG
ATTATTATGAAAATATTATTTATTATATTATACCCTGTGAATTTTCTAAGAGAATTGACT
ATACCTTTTTATACAAAAGAGAACTGGAGTAGGATGAAAGCGAGTTTTTTCCCAATATCT
GCTGGGATTTTTATTATATATACCCAAGATTTGTTTTATGTTCAGATTTATAATTTCCCT
CTTTGGATATTTATAGTTTTTACTAGTATATTCCTAGGAATAATGATTTTCTGTACATCC
AAAAGGACTGTGCTTCCAAGTTATAATGGTAAACTCAAAGCTCTATCTTTTTTTATTAGT
GTACTTTGGATCTGTACAATTTGTGAAATCATGATCGACTTATTAGCTTTGACTGGTACA
TTATTAGGCTTACCAATTAGTTTTTTAGGTTTAAGTCTATTAGCTTGGGGGAACTCAGCA
GGGGATTTCTGGGCTAATCCTGCTATAGCACGTTTAGGAATGGGTCAAACAGCAATTACA
GCATGTTTTGCTGGACCTTTATTCAATACTTTAATAGGTTTTGGGGTTTCTATGATTGTT
GGATGCACACAAAGCAAACTAACTTTTCATATACTTAATCATAAAGAACTGCTTATTGCT
GGAGCTTTTTTATTAGTATCAAGTGCGATTACTGGGGTTTTCTTGATTAGAAATACTGGG
AAAATTGTCAGAAATCATGGGTTATTCCAAATTTGTATCTATTTAGTTTTTAGTGCAAGT
TTGTTAGCGTATACATTTTTATAA