Identifiers and Description

Gene Model Identifier

SteCoe_30449

Standard Name

None

Aliases

None

Description

Glyco_transf_4 domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Tetrahymena ThermophilaTTHERM_003359602.820770088460135e-53Presumed early mannosyltransfe
rase involved in the N-linked
glycosylation pathway
WormBaseWBGene000172826.813556821545298e-46
Oxytricha TrifallaxContig4487.0.g267.47197233734299e-43Glycosyl transferases group 1

Saccharomyces CerevisiaeYGL065C1.8048513878454153e-35Mannosyltransferase in the N-l
inked glycosylation pathway; c
atalyzes two consecutive steps
in the N-linked glycosylation
pathway; alg2 mutants exhibit
temperature-sensitive growth
and abnormal accumulation of t
he lipid-linked oligosaccharid
e Man2GlcNAc2-PP-Dol

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_30449(Protein)
MSLKKNVAIIHPDLGIGGAEQLIVNIALALQMSGYEVTIFTPRHEKERSFKPTHDGTLNV
QVKGSIFPSSIFGKCTALCSMIRMFLASLYVILFGGEYDFIIIDQVSAILPIFYLSSSKV
IFYCHFPDQLLCTQRQSSIKRLYRFFIDKVEEIGLWKPDLIYVNSNFTLSITKSTFKSLA
SINLHILYPCIDLNFISNAPYPQFFENSKYFFSLNRYERKKNINLAIEAYSSLKDKSVKL
LIGGGYDPKMQENVEHYAELCELCKKLELKYVEVDNWDKPIKNFDVYFVRNLSEIQREQA
LQNALGVLYTPENEHFGIVPVESMARGTPVIAINSGGPMESVKNELSGFLLDKDPKKWGE
KMMMLSEDNEKRTKVGAYAKEWALKEFSLSSMSSKLNEDFQKLLKP


>SteCoe_30449(CDS)
ATGTCTTTGAAAAAAAACGTAGCAATCATCCATCCAGATCTTGGGATTGGAGGAGCAGAA
CAGTTAATAGTAAACATCGCTTTAGCCCTACAAATGTCTGGTTATGAAGTTACTATCTTT
ACTCCAAGACATGAAAAGGAAAGAAGTTTTAAGCCTACTCATGATGGTACTTTAAATGTT
CAAGTTAAAGGTAGTATTTTCCCATCAAGTATCTTTGGTAAATGTACAGCTCTTTGTAGT
ATGATTCGAATGTTCTTAGCTAGTCTTTATGTAATTCTTTTTGGTGGGGAATATGACTTT
ATAATAATAGACCAAGTTTCAGCTATTTTACCTATTTTCTATCTGAGTTCTAGTAAAGTT
ATATTTTATTGTCATTTCCCAGATCAACTTTTATGCACCCAGCGTCAAAGTTCAATCAAG
CGTTTATATCGTTTTTTTATTGACAAAGTTGAAGAAATAGGTTTATGGAAGCCAGACCTC
ATATATGTAAACAGCAATTTTACCCTTTCTATAACGAAATCGACTTTTAAATCTTTAGCT
TCAATAAACCTTCATATTTTATACCCATGCATTGACTTGAATTTTATTTCAAACGCTCCT
TATCCACAATTTTTTGAAAATTCAAAGTACTTTTTTTCTTTAAATCGATATGAACGTAAA
AAAAACATTAACTTAGCTATAGAAGCGTATTCATCTTTAAAAGACAAATCAGTCAAACTA
CTTATTGGTGGAGGTTATGATCCTAAAATGCAAGAAAATGTTGAACATTATGCAGAATTG
TGTGAATTGTGTAAGAAATTAGAGCTTAAATATGTTGAAGTTGACAATTGGGATAAACCT
ATTAAGAATTTTGACGTGTATTTTGTTAGAAATTTATCGGAAATACAACGTGAGCAGGCT
TTACAGAATGCGTTGGGTGTTTTGTATACACCTGAAAATGAACATTTTGGCATTGTCCCA
GTAGAATCTATGGCAAGAGGGACTCCAGTAATAGCAATAAACAGTGGTGGACCTATGGAA
AGTGTTAAAAATGAATTGAGTGGGTTTCTTTTAGATAAAGATCCTAAAAAATGGGGGGAA
AAAATGATGATGCTGAGCGAAGACAATGAAAAAAGAACCAAGGTAGGTGCTTATGCTAAA
GAGTGGGCTTTAAAGGAATTTTCATTAAGTTCTATGAGTTCCAAACTAAATGAAGATTTT
CAGAAACTCTTAAAACCTTAA