Identifiers and Description

Gene Model Identifier

SteCoe_30495

Standard Name

None

Aliases

None

Description

zf-rbx1 domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Oxytricha TrifallaxContig254.1.g192.6102790696677047e-23RING-H2 zinc finger

Tetrahymena ThermophilaTTHERM_003137101.9287498479639178e-22RING finger protein
WormBaseWBGene000043205.242885663363464e-22
Saccharomyces CerevisiaeYOL133W5.74952226429356e-19RING-H2 domain core subunit of
multiple ubiquitin ligase com
plexes; subunit of Skp1-Cullin
-F-box (SCF) that tethers the
Cdc34p (E2) and Cdc53p (cullin
) SCF subunits, and is require
d for degradation of Gic2p, Fa
r1p, Sic1p and Cln2p; subunit
of the Rtt101p-Mms1p-Mms22p ub
iquitin ligase that stabilizes
replication forks after DNA l
esions; subunit of the Cul3p-E
lc1p-Ela1p ubiquitin ligase in
volved in Rpb1p degradation as
part of transcription-coupled
repair

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_30495(Protein)
MEQGKRFEVKKWNAVAMWAWDIEVENCAICRTHINDPCIDCQANQQSTTSEECNVAWGVC
NHAFHFHCISRWLKTRHVCPLDNRDWEFQRLGK


>SteCoe_30495(CDS)
ATGGAACAAGGAAAGAGATTCGAAGTTAAAAAATGGAATGCTGTTGCTATGTGGGCCTGG
GATATTGAAGTTGAAAATTGTGCTATCTGTAGAACTCATATAAACGATCCATGCATTGAC
TGTCAAGCCAATCAGCAATCAACAACATCTGAAGAATGCAATGTAGCTTGGGGAGTTTGC
AATCATGCTTTTCACTTTCATTGTATCTCAAGATGGCTTAAAACAAGACATGTATGCCCA
CTTGATAATAGAGATTGGGAATTCCAAAGATTAGGTAAATAA