Identifiers and Description

Gene Model Identifier

SteCoe_3075

Standard Name

None

Aliases

None

Description

ATP-synt_ab_N domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Oxytricha TrifallaxContig908.1.g930ATP synthase alpha/beta family
, nucleotide-binding domain

WormBaseWBGene000069210

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_3075(Protein)
MADVRAARINALAASRDYMVDPIIDYRTVIGVEGPLVILENVKFPKYAEIVNVHLGDGTM
RRGQVLEISGKRAVVQIFEGTSGIDSLRTRCEFTGDTMHMPISEEMLGRTFNGSGRPIDK
GPQVLAEEMINIQGQPINPYMRVYPKEMIQTGISAIDVMNSIARGQKIPLFSAAGLCHNE
IGAQICRQAQLVKGKGVMDHSEENFCLVFAAMGVNAETARFFRTDFEENGAMDRVALFMN
HADDPTIERIITPRLALTTAEYLAYERELHVLVIMTDMSAYADALREISAAREEVPGRRG
YPGYMYTDLSTIYERAGRVSGKNGSITQLPILTMPNDDITHPIPDLTGYITEGQIFIDRS
LHNRQVYPPINVLPSLSRLMKSAIGKGMTRIDHPLVSDQLYANYAIGKDTQAMKAVVGEE
ALTADDFLYLEFLEKFEGKFLTQALNENRSIEESLDLAWSLLRIFPLDKLKKINTEDVKA
FYNRENQLERARKEQENLKERVKGN


>SteCoe_3075(CDS)
ATGGCTGACGTCCGTGCCGCAAGAATCAATGCCTTAGCTGCATCTCGAGACTACATGGTT
GATCCTATAATAGATTATCGAACAGTTATTGGTGTAGAAGGCCCATTAGTAATTCTCGAG
AACGTGAAATTCCCAAAATACGCAGAAATCGTCAATGTTCATTTAGGAGATGGGACAATG
CGTCGAGGACAAGTATTAGAAATTTCAGGAAAACGAGCTGTTGTGCAGATTTTCGAAGGT
ACTTCAGGTATTGACTCTTTAAGAACCCGTTGCGAATTCACTGGTGACACTATGCATATG
CCTATAAGCGAAGAAATGCTTGGAAGAACCTTCAATGGTTCAGGTAGGCCAATCGATAAA
GGTCCTCAAGTTTTAGCTGAAGAAATGATTAATATCCAAGGGCAGCCAATCAATCCTTAT
ATGAGAGTTTATCCTAAAGAAATGATCCAAACAGGCATCAGCGCTATTGATGTCATGAAC
TCAATTGCCAGAGGACAAAAAATCCCCCTTTTTTCAGCAGCTGGTTTATGTCACAATGAA
ATCGGTGCTCAAATCTGTCGTCAAGCTCAACTTGTTAAAGGTAAAGGTGTTATGGACCAT
TCTGAAGAAAATTTCTGTTTAGTCTTTGCCGCAATGGGTGTTAATGCTGAAACTGCACGC
TTTTTCAGAACAGACTTCGAAGAAAATGGTGCTATGGATCGTGTTGCTTTGTTTATGAAC
CATGCTGATGATCCTACAATAGAAAGAATTATTACCCCAAGGTTAGCTTTGACTACAGCT
GAATATTTAGCTTATGAACGTGAATTACATGTTTTAGTTATTATGACTGATATGTCTGCA
TATGCTGATGCTCTTAGAGAAATCTCAGCTGCTCGTGAAGAAGTCCCTGGCCGAAGAGGT
TATCCAGGGTATATGTATACTGATCTTAGCACTATATATGAACGTGCTGGACGTGTTAGT
GGAAAAAATGGTTCAATTACTCAGTTACCTATTTTGACTATGCCTAATGATGATATAACA
CATCCAATTCCTGATTTAACTGGATATATTACAGAAGGACAAATTTTTATTGATAGAAGT
TTACATAATAGACAGGTATATCCACCTATTAATGTTTTACCTAGTTTATCACGTTTAATG
AAAAGTGCTATTGGTAAAGGAATGACTAGGATTGATCATCCATTAGTTTCTGATCAACTT
TATGCTAATTATGCTATTGGGAAAGATACACAGGCTATGAAAGCTGTCGTTGGTGAAGAA
GCTTTGACTGCAGATGATTTTTTGTATTTGGAGTTTTTAGAAAAGTTTGAAGGCAAGTTT
TTGACACAGGCTTTGAATGAAAATAGGAGTATTGAGGAAAGTTTGGATTTAGCTTGGAGT
TTGTTGAGGATTTTCCCATTGGATAAACTGAAGAAAATCAATACTGAGGATGTTAAAGCG
TTTTATAATAGGGAGAATCAGTTGGAAAGAGCTAGGAAGGAACAGGAAAACCTTAAGGAA
AGAGTTAAAGGGAATTAA