Identifiers and Description

Gene Model Identifier

SteCoe_30854

Standard Name

None

Aliases

None

Description

tRNA-synt_2d domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Oxytricha TrifallaxContig1385.1.g550tRNA synthetases class II core
domain (F)

WormBaseWBGene000014970
Tetrahymena ThermophilaTTHERM_001336902.7086952666810816e-76phenylalanyl-tRNA synthetase,
alpha subunit family protein
Saccharomyces CerevisiaeYFL022C1.314164668364901e-67Alpha subunit of cytoplasmic p
henylalanyl-tRNA synthetase; f
orms a tetramer with Frs1p to
form active enzyme; evolutiona
rily distant from mitochondria
l phenylalanyl-tRNA synthetase
based on protein sequence, bu
t substrate binding is similar

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_30854(Protein)
MEAELLKDLAQKDIENSLLYARGKGWDHTELVGLLTSLGLEGYLQTENFKMEELVLTPEG
TTYLELGSPEAQVVKFLTSSGKVTQDVLMSNLGNIGKIGFAQAMKNKWIAIEKDTKLVNI
TTQEIQDAVQISLKAISNGEASKDLESLKKRKLVENAKRGYCKVTKGPNFREVRVKGEAD
ITYELLKTEKWKTAVFKDYNFDALGKDPEGGHLHPLLKVRAQLRRILLEMGFEEMPTNNF
VESSFWNFDSLFQPQSHPARDAHDTFFLKDPISSANSDPEYVQRVKTMHESGDETSIGWN
YNWSLQEAEKNILRTHTTAVSSRMLYKLAQEGFRPKKYFSIDRVFRNENLDATHLAEFHQ
IEGVIADRGLGLGDLMGVIQEFFRRMGITNIKFKPAYNPYTEPSLEIFGYHPILKKWTEI
GNSGIFRPEMLKPMGLPEDVAVIAWGLSLERPTMIQYGLDNIRDLFGSKADLNYIRNNPV
CRFNS


>SteCoe_30854(CDS)
ATGGAGGCTGAGTTGCTCAAAGACCTGGCTCAAAAGGACATAGAAAACTCCCTATTGTAC
GCACGTGGCAAAGGGTGGGATCATACAGAACTGGTTGGTCTTTTAACAAGTCTTGGCCTT
GAAGGCTACCTCCAAACTGAGAACTTTAAAATGGAAGAACTTGTCTTAACTCCAGAAGGG
ACAACTTATCTTGAACTTGGTTCGCCTGAAGCTCAGGTTGTAAAATTCCTCACAAGCTCA
GGAAAAGTTACTCAGGATGTCCTTATGAGCAATTTAGGGAACATAGGCAAAATCGGCTTT
GCACAAGCTATGAAAAACAAATGGATTGCCATAGAAAAGGATACAAAGCTTGTAAACATC
ACCACTCAAGAAATCCAAGATGCAGTCCAAATCTCATTAAAAGCTATTTCCAATGGCGAA
GCCAGTAAAGATCTTGAATCTCTCAAAAAACGCAAGCTTGTTGAAAATGCAAAAAGAGGC
TACTGCAAAGTTACTAAAGGTCCAAACTTCAGAGAAGTCCGTGTCAAAGGTGAAGCTGAC
ATTACATACGAGCTTCTAAAAACTGAGAAATGGAAAACAGCAGTTTTTAAAGACTACAAC
TTTGATGCTTTAGGTAAAGACCCAGAAGGAGGGCATTTACACCCATTATTAAAAGTTCGT
GCACAGCTAAGAAGAATATTATTAGAAATGGGCTTTGAGGAAATGCCTACAAATAACTTT
GTAGAAAGTAGCTTCTGGAACTTTGATTCACTTTTTCAACCACAGTCACACCCTGCTAGA
GATGCCCATGATACATTTTTCCTTAAAGATCCGATAAGTTCAGCTAACTCTGACCCTGAA
TATGTTCAAAGAGTTAAAACTATGCATGAAAGCGGAGATGAGACAAGTATTGGGTGGAAT
TACAATTGGAGTCTTCAGGAAGCTGAGAAAAATATCCTTCGTACTCACACTACTGCCGTA
TCATCAAGAATGCTTTATAAGCTTGCCCAAGAAGGTTTTAGACCAAAAAAGTACTTTAGT
ATTGACAGGGTATTTAGAAATGAAAACTTAGACGCTACTCATCTAGCTGAATTCCATCAA
ATAGAAGGTGTTATAGCAGATCGTGGATTAGGCTTAGGCGATTTAATGGGTGTTATTCAA
GAATTCTTTAGAAGAATGGGTATCACAAATATCAAATTCAAGCCTGCTTATAACCCTTAT
ACCGAACCCAGTCTAGAAATTTTTGGGTATCATCCAATACTTAAGAAATGGACTGAAATC
GGCAATTCTGGGATTTTCAGACCTGAAATGCTCAAACCTATGGGCTTACCAGAAGATGTT
GCTGTCATCGCTTGGGGTTTGTCATTAGAAAGACCTACTATGATTCAGTATGGGCTTGAT
AATATTCGCGATTTGTTCGGATCTAAAGCTGATCTCAATTATATACGCAATAATCCTGTA
TGCCGTTTTAATAGCTAG