Identifiers and Description

Gene Model Identifier

SteCoe_30948

Standard Name

None

Aliases

None

Description

adh_short domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Tetrahymena ThermophilaTTHERM_002207102.6786369618080778e-33hypothetical protein
Oxytricha TrifallaxContig22507.0.g76.47023492564546e-26short chain dehydrogenase

WormBaseWBGene000113983.1391327920480296e-17

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_30948(Protein)
MQALARRSVIIGGNGALGKKVVEVFRDSWEVTSVDFKSNSLAHKNLVLPQGSTELHHSFC
KENLSGKYDAMICVAGGWVGGNIANPEIFAQTRQMIEINLYPSLLTCHLATSFLNENGLI
ILTGAASVFKDVTPGNLAYGLAKTAVHSLALNMATQESIPNTSVVSTILPEIIDTPSNRA
AMPDANFSTWCDPIAIAGLIKMWAEGNNRPSNGSFAVLKSINGSIVPEFV


>SteCoe_30948(CDS)
ATGCAAGCTTTAGCAAGGAGAAGTGTTATTATTGGAGGCAATGGAGCACTGGGCAAAAAA
GTTGTTGAAGTCTTCAGGGATTCATGGGAAGTCACTTCTGTCGACTTTAAAAGCAACTCT
CTTGCTCATAAAAATCTTGTCCTTCCACAAGGCAGTACTGAACTCCATCACAGCTTCTGC
AAAGAAAACCTTTCAGGGAAATACGACGCTATGATCTGTGTTGCAGGAGGCTGGGTCGGT
GGGAACATCGCGAATCCAGAAATATTTGCCCAAACGCGACAAATGATCGAGATAAATCTA
TACCCATCATTACTAACTTGTCATTTAGCCACATCTTTTCTTAACGAAAACGGGCTTATT
ATTCTAACTGGAGCAGCTTCAGTGTTTAAAGATGTGACACCAGGAAATCTAGCTTATGGT
TTAGCTAAAACTGCAGTTCATAGTTTAGCTTTGAATATGGCTACACAAGAAAGTATCCCA
AATACTTCAGTTGTTAGTACAATATTACCAGAAATAATCGATACACCTAGTAATAGAGCT
GCTATGCCTGATGCAAATTTTTCTACTTGGTGTGACCCTATAGCTATAGCTGGATTGATA
AAAATGTGGGCTGAAGGAAATAATAGACCAAGCAATGGGAGCTTTGCTGTATTAAAGTCT
ATAAACGGAAGTATTGTCCCAGAATTTGTTTAG