Identifiers and Description

Gene Model Identifier

SteCoe_30975

Standard Name

None

Aliases

None

Description

Kelch_1 domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Tetrahymena ThermophilaTTHERM_004730100.000000000000012664165549094176Kelch motif family protein
Oxytricha TrifallaxContig1413.1.g890.00000000000009357622968840175AMP-binding enzyme

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_30975(Protein)
MESVSIGVSRSHWKELLDKTNAPSPRSGHSAVIFSSSMYIFAGHNGTNVVNDHYRLNLIT
CKWEKLSENSNLPCLPSARTSHSAAVDNLAGLIYVFGGSGKDFGSSNKNDMFVYAIRDNV
WEGLSPQGSGPGARYGHSMTLFNSALYVFGGTSGTVFFNDLYLFELDKHCWIQLTIKQNP
PPIRYKHSARVLNNXWIQLTIKQNPPPIRYKHSARVLNNKLLIIGGAEYKTVLKDIWEID
LETLSSSKLEIQSTNLLANTAQAAEVYKSSIYLLGEYSQQQAASSLWKMNLKKKNWVEEI
QLGSRPPAMTFFTMVLCEGYLVIFGGNINEVRTNKTFVFRLSMYIPEQKSPIGRLYNLMI
SEGPHSDTLVQSLEMGFFSQQIVLKIRCPLLCQESVNQGNIMLVSLPYSAETVRALLLYV
YQDIVDPLMSLQATLSLFSIAAIYGIPPLLNKLCLILCRSLLSTTAKSIANYISRNSVEK
LFHRNEFRDNINKFPKTSTLDEILIKHMTENLELTSGEQVYWEAIEKLTRGKSLSELSDT
VKADIVRLKAKDAGKSLSPKTAQSHDISDLQWSLTLLYQTPKDTQILASGTKLSAHKSIL
ISNSEYFEAYFISNKSQEPCSLDIPPDIAQHLILYMYFGPKGIQELDAEIQSSLMPYADY
LMITNKQLHDYIGNMITDILDKDNVFQYLLSSHRMNATIMKHMILEYFIENYKELVEKEE
MFGLPVEILVEIHRWNASKFP


>SteCoe_30975(CDS)
ATGGAATCAGTGAGCATTGGAGTTTCTAGAAGCCACTGGAAAGAACTTCTTGATAAAACT
AACGCCCCATCTCCTCGTAGTGGTCATTCTGCTGTAATTTTTTCATCATCCATGTATATT
TTTGCTGGTCACAATGGGACAAATGTTGTAAATGATCATTACAGGCTTAATCTTATTACT
TGTAAATGGGAAAAACTTTCTGAAAACTCTAATTTACCTTGTTTACCTTCTGCAAGAACT
TCACATAGTGCTGCTGTTGATAATCTTGCTGGGCTTATTTATGTTTTTGGAGGAAGTGGT
AAAGATTTTGGAAGTTCTAATAAAAATGATATGTTTGTTTATGCTATTAGAGATAATGTA
TGGGAAGGACTTTCACCACAGGGATCAGGTCCTGGAGCGAGGTATGGACATTCGATGACA
CTTTTTAATTCGGCTTTGTATGTTTTTGGAGGCACTAGTGGCACTGTTTTTTTTAATGAC
CTTTATCTTTTTGAACTTGATAAGCATTGCTGGATACAATTGACTATTAAACAGAATCCT
CCACCAATAAGATACAAGCATTCTGCACGTGTTTTAAACAATAANTGGATACAATTGACT
ATTAAACAGAATCCTCCACCAATAAGATACAAGCATTCTGCACGTGTTTTAAACAATAAA
CTGCTAATAATCGGAGGTGCTGAGTACAAAACTGTGCTAAAGGACATCTGGGAAATTGAT
CTTGAGACCTTATCAAGTAGTAAACTTGAAATCCAAAGCACAAACCTTTTAGCCAATACA
GCCCAAGCAGCCGAAGTATACAAATCCAGCATCTATTTATTAGGTGAATATTCTCAACAA
CAAGCTGCCTCAAGCTTATGGAAAATGAATCTTAAAAAAAAAAACTGGGTTGAAGAAATC
CAATTAGGAAGCCGCCCTCCAGCAATGACATTTTTTACAATGGTTCTTTGTGAAGGATAT
TTAGTTATATTTGGTGGGAATATAAATGAAGTAAGGACAAATAAAACTTTTGTATTCAGA
CTTTCCATGTATATTCCTGAACAAAAATCACCTATTGGCCGGCTTTATAATTTAATGATA
TCAGAAGGTCCACATTCTGATACTTTAGTCCAGTCTTTAGAAATGGGTTTTTTTTCTCAG
CAGATTGTATTAAAGATTAGATGCCCTTTGCTTTGTCAGGAAAGTGTGAATCAAGGGAAT
ATTATGCTTGTTAGTTTACCATACTCAGCTGAGACTGTGAGAGCTTTGTTACTTTATGTA
TATCAGGATATTGTTGACCCACTTATGTCTTTGCAGGCTACGTTGTCACTTTTTTCTATT
GCTGCTATATATGGAATCCCTCCTCTTCTCAATAAACTCTGCCTAATCCTCTGCCGATCT
CTTTTAAGTACAACAGCAAAATCAATAGCAAACTACATTTCAAGGAATTCAGTCGAAAAG
CTTTTCCACCGCAACGAATTCCGAGACAATATAAACAAATTCCCAAAAACCTCAACTTTA
GATGAGATCCTAATAAAACACATGACCGAAAACTTAGAATTAACAAGTGGTGAGCAAGTA
TATTGGGAAGCAATAGAAAAACTCACAAGGGGCAAATCTTTATCCGAGCTTTCCGATACA
GTAAAAGCTGATATAGTAAGACTAAAAGCAAAAGATGCAGGAAAAAGCCTAAGCCCAAAA
ACAGCTCAGTCTCACGATATAAGCGATCTTCAATGGTCTTTAACTTTACTATATCAAACC
CCAAAAGATACACAAATACTAGCATCAGGGACAAAATTATCAGCACATAAATCAATCCTT
ATAAGTAATTCTGAGTATTTTGAAGCATATTTTATATCAAATAAATCTCAAGAACCTTGT
TCACTTGATATACCCCCAGATATAGCCCAACATCTTATATTATATATGTATTTTGGCCCT
AAAGGTATACAAGAACTTGATGCTGAAATCCAAAGTTCTTTAATGCCTTATGCAGATTAT
TTAATGATTACAAATAAACAACTTCATGATTATATTGGGAATATGATTACTGATATTCTT
GATAAGGATAATGTTTTTCAGTATCTTTTAAGTTCACATCGGATGAATGCTACAATTATG
AAACATATGATTTTGGAGTATTTTATTGAAAATTATAAAGAACTTGTTGAGAAAGAAGAG
ATGTTTGGACTTCCTGTTGAGATTTTGGTTGAAATTCATAGATGGAATGCGAGCAAATTT
CCTTAG