Identifiers and Description

Gene Model Identifier

SteCoe_31046

Standard Name

None

Aliases

None

Description

Histone domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Oxytricha TrifallaxContig9772.0.g991.185064864233981e-27Core histone H2A/H2B/H3/H4

Tetrahymena ThermophilaTTHERM_007907908.75651076269652e-27Histone H2A; one of the four h
istones (H2A, H2B, H3 and H4)
that comprise the nucleosome c
ore; one of two major histone
H2A genes (with HTA2); knockou
t viable, but double knockout
with HTA2 inviable
Saccharomyces CerevisiaeYDR225W3.532628572200807e-24Histone H2A; core histone prot
ein required for chromatin ass
embly and chromosome function;
one of two nearly identical s
ubtypes (see also HTA2); DNA d
amage-dependent phosphorylatio
n by Mec1p facilitates DNA rep
air; acetylated by Nat4p; N-te
rminally propionylated in vivo
WormBaseWBGene000018869.602680054508676e-24

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_31046(Protein)
MATIGKGKGTRGKAANATKTSRSQKAGLQFPVGRISRFMKQGKYAERIGAGAPVYLAAVL
EYLAAEVLELAGNAAKDYKKTRIVPRHIQLAIRNDEELNKLMANTTIANGGVTPFIHSAL
LPEGVKEKDGEAQDI


>SteCoe_31046(CDS)
ATGGCAACTATCGGTAAAGGAAAAGGAACAAGAGGCAAAGCAGCAAATGCAACAAAAACT
TCCAGATCACAAAAGGCAGGACTTCAATTCCCTGTAGGTAGAATCAGCAGATTCATGAAA
CAAGGAAAATATGCTGAAAGAATCGGAGCAGGTGCACCAGTTTATCTTGCTGCCGTTCTT
GAATATCTTGCAGCTGAAGTTCTTGAACTTGCAGGAAATGCTGCTAAGGATTATAAGAAG
ACTAGGATTGTCCCAAGACATATTCAGTTGGCTATTAGAAATGATGAAGAACTTAACAAA
CTTATGGCTAATACTACAATTGCTAATGGAGGTGTTACACCATTTATTCATAGCGCTTTG
TTACCAGAAGGTGTTAAAGAGAAAGACGGAGAAGCTCAAGACATTTAA