Identifiers and Description

Gene Model Identifier

SteCoe_31065

Standard Name

None

Aliases

None

Description

CK_II_beta domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Tetrahymena ThermophilaTTHERM_007805303.0144087850653746e-40Casein kinase II regulatory su
bunit family protein
Oxytricha TrifallaxContig1990.0.g43.0144087850653746e-40Casein kinase II regulatory su
bunit

WormBaseWBGene000021961.185064864233981e-27
Saccharomyces CerevisiaeYOR039W2.6102790696677047e-23Beta' regulatory subunit of ca
sein kinase 2 (CK2); a Ser/Thr
protein kinase with roles in
cell growth and proliferation;
CK2, comprised of CKA1, CKA2,
CKB1 and CKB2, has many subst
rates including transcription
factors and all RNA polymerase

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_31065(Protein)
MASQEESSSSGYSDMTWIQWFCGMEGHEFFVEVEEDYINDTFNLYGLKAMFPQYQEAIEL
ILSPTCPDEEEMKQQSYLELYQEAADLYGLIHARFIISQSGMELMREKYIAGSFGLCPRV
MCEKQPVLPIGISEELRTSRVKLYCPKCQDIYFPKQKLSDVDGAYFGTSFPHLFFLNFPD
IVIEKSSKNYAPKLYGFKLYGRKGSKYESNYNN


>SteCoe_31065(CDS)
ATGGCCAGCCAAGAGGAATCAAGCTCCAGCGGATACTCTGATATGACTTGGATTCAATGG
TTTTGTGGAATGGAAGGACATGAGTTTTTTGTGGAAGTGGAAGAAGATTATATTAACGAC
ACATTTAATTTATACGGTCTTAAAGCCATGTTTCCACAATACCAAGAAGCTATCGAACTT
ATTCTCTCACCAACTTGCCCAGATGAAGAAGAAATGAAGCAGCAAAGTTACTTAGAATTA
TACCAAGAAGCTGCAGATCTATATGGACTTATCCATGCAAGGTTTATTATTTCACAATCT
GGCATGGAATTGATGAGAGAAAAATACATTGCTGGAAGTTTCGGACTCTGCCCAAGAGTT
ATGTGTGAAAAACAACCTGTATTGCCTATTGGTATTTCAGAAGAATTAAGAACTAGTCGT
GTTAAGCTTTACTGCCCAAAATGCCAGGATATTTATTTTCCTAAGCAAAAGCTTTCTGAT
GTAGATGGGGCATACTTTGGCACATCATTTCCGCATTTGTTTTTCCTTAATTTTCCTGAT
ATTGTTATAGAGAAAAGCTCTAAAAATTATGCTCCTAAACTATATGGCTTCAAATTATAC
GGAAGAAAGGGGTCAAAGTATGAAAGCAATTATAATAATTAG