Identifiers and Description

Gene Model Identifier

SteCoe_31088

Standard Name

None

Aliases

None

Description

Enolase_N domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Oxytricha TrifallaxContig15891.0.g720Enolase, C-terminal TIM barrel
domain

WormBaseWBGene000118840

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_31088(Protein)
MAEILDVKAREILDSRGNPTVEVDIITSLGEFRAAVPSGASTGVYEALELRDGDHKRYLG
KGVLKAVKNVQDIIKPAILGKLVTDQNDIDKFMVEELDGSENDWGWSKSRLGANAVLAVS
LAIARAGAKHSGIPLYQYIARLAGNNEENFIMPVPALNVINGGSHAGNKLAMQEFMLLPI
GASSFREAMQIGTEVYHNLKSVIKSKYGLDATNVGDEGGFAPCIQDNTTALNLLIEAINK
AGHTGKVFIGMDVAASEFYKGEDNKYDLDFKNPNNDGTQKLTGEELSNVYRNFANLYPLI
SIEDPFDQDDWESYSLLTEAIGTGVQIVGDDLLVTNPTRVKKAIHLKACNALLLKVNQIG
SLTEAIEACKLAQNEGWGVMVSHRSGETEDNFIADLVVGLGTGEIKTGAPCRSERLSKYN
QLLRIEEELGSRAVYAGAKFRNPRV


>SteCoe_31088(CDS)
ATGGCCGAGATATTGGATGTAAAAGCTCGTGAGATTTTAGACTCTCGAGGCAACCCAACA
GTAGAAGTTGATATCATAACATCATTAGGGGAATTTAGAGCTGCTGTTCCTAGTGGTGCT
TCAACAGGAGTTTATGAAGCTTTAGAACTTAGAGATGGTGACCATAAAAGATATCTAGGA
AAAGGTGTACTTAAAGCAGTAAAAAATGTACAAGATATAATCAAACCTGCAATATTAGGC
AAACTTGTCACTGATCAGAATGATATAGACAAATTTATGGTCGAAGAACTTGATGGAAGT
GAAAATGATTGGGGTTGGTCTAAATCACGTTTAGGAGCTAATGCTGTATTGGCCGTATCT
TTAGCCATAGCAAGAGCTGGAGCTAAACATTCAGGTATCCCTTTATATCAATATATAGCC
CGATTAGCTGGAAATAACGAAGAAAATTTCATTATGCCAGTACCAGCACTTAATGTTATA
AACGGTGGGTCTCATGCTGGTAATAAATTAGCTATGCAAGAATTTATGCTTTTACCTATT
GGGGCAAGTTCATTTAGAGAAGCTATGCAAATAGGAACTGAAGTATATCATAATCTTAAA
AGTGTTATAAAAAGCAAATATGGTCTTGATGCTACAAATGTTGGTGATGAAGGGGGTTTT
GCACCATGTATTCAAGATAATACCACAGCTTTAAATTTACTTATAGAAGCTATAAATAAA
GCTGGGCATACAGGAAAAGTGTTTATAGGAATGGATGTTGCTGCATCAGAGTTTTATAAA
GGTGAAGATAATAAATATGACCTTGACTTTAAAAACCCAAATAATGATGGTACGCAAAAG
CTTACAGGTGAAGAACTTTCTAATGTTTATAGAAACTTTGCTAATCTATATCCTTTAATA
TCAATAGAAGATCCATTTGATCAAGATGATTGGGAGAGTTATTCATTATTAACTGAAGCT
ATTGGTACAGGTGTACAGATAGTTGGTGATGATTTATTAGTAACAAATCCAACAAGGGTT
AAAAAAGCTATACATTTAAAAGCTTGTAATGCTTTATTACTAAAAGTTAATCAAATTGGG
TCTTTAACTGAGGCAATTGAAGCTTGTAAATTAGCTCAAAATGAAGGATGGGGGGTGATG
GTAAGTCATCGTAGTGGAGAAACTGAAGATAATTTTATAGCAGATTTAGTAGTTGGCTTA
GGGACTGGAGAAATCAAAACTGGTGCACCATGTAGATCAGAAAGGTTATCGAAATACAAT
CAATTGTTAAGAATCGAAGAAGAACTTGGATCACGGGCTGTTTATGCAGGGGCTAAGTTT
AGAAACCCTAGAGTTTAG