Identifiers and Description

Gene Model Identifier

SteCoe_3118

Standard Name

None

Aliases

None

Description

WD40 domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Tetrahymena ThermophilaTTHERM_000755903.4811068399043105e-57peptidyl-prolyl cis-trans isom
erase, cyclophilin-type family
protein
Oxytricha TrifallaxContig10554.0.g221.5400882849875202e-51Cyclophilin type peptidyl-prol
yl cis-trans isomerase/CLD

WormBaseWBGene000008914.1863939993042314e-51
Saccharomyces CerevisiaeYDR304C2.3195228302435696e-16Peptidyl-prolyl cis-trans isom
erase (cyclophilin) of the ER;
catalyzes the cis-trans isome
rization of peptide bonds N-te
rminal to proline residues; tr
anscriptionally induced in res
ponse to unfolded proteins in
the ER; CPR5 has a paralog, CP
R2, that arose from the whole
genome duplication

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_3118(Protein)
MKATQKVLSEDIDLYLQRLPNSDIYELSYLHKDEIQCISASTNTSIIATGSQDGVVKFWK
KLYRGIEFAKQFRAHVSAVSQIAFSQIGSKAASISYSDCIIKIYDSLSLDMIDKLTLNDP
VLYLEIAQDIQDAEPYILACTQAGLVVAEMISNPVQKKIDIHASKALVVAYNAHKKTCIS
ADENGVIEYWRKESAEMPDDVDFRFKVQTDLYVLAQNKETPVSLTISPSGNLFCIYTASR
VFRIYNYSTGKIMTKFEEAYEDYQEIQNNPSSDLRLERIEFYRRIALEKDMDKNLERLNA
VWDESEEIIIYAAYIGIKFRLVSTGEVIRIIAKSETPRFTQLFLYQGVPMLNTSGKAGLG
GSSSQGFKEIDPIIFAIGYHRTRFYLFTKRNPADEGKEDTRDIMNETITDDSKCLVMQQK
PSIRLAKSAVIHTTMGDITIKLFPKQCPRTVENFTGHCMNGYYSQQIFHRVIKGFMIQTG
DPEGNGHGGTSIWGGEFEDEISEDLKHDRPFTVSMANRGPNTNGSQFFITTVAASWLNGR
HTLFGRVAKGMDTVCRIEGVPCDKKNKPKADIRIVDITINLD


>SteCoe_3118(CDS)
ATGAAAGCAACACAAAAAGTACTTTCTGAAGATATTGACCTATATTTGCAGCGCTTACCA
AACAGTGACATATACGAGCTAAGCTATTTGCACAAAGATGAAATCCAGTGCATATCAGCA
TCAACAAATACCAGCATAATTGCCACTGGAAGTCAGGATGGAGTAGTAAAGTTTTGGAAG
AAACTATATCGTGGTATAGAATTCGCTAAACAATTCAGAGCGCATGTTTCCGCAGTGAGC
CAAATTGCATTTTCACAAATCGGATCAAAAGCTGCCTCTATCTCATATTCTGATTGCATA
ATAAAAATCTATGATTCCCTTAGCTTAGACATGATAGACAAGCTAACATTAAATGACCCA
GTCTTATATTTAGAAATAGCTCAAGATATTCAAGATGCTGAGCCTTATATTTTAGCATGT
ACACAAGCAGGTTTAGTAGTAGCTGAAATGATATCAAATCCTGTACAAAAAAAAATTGAT
ATTCATGCAAGTAAAGCATTGGTTGTTGCATATAATGCACATAAAAAAACTTGTATTAGC
GCTGATGAGAATGGGGTTATTGAGTATTGGCGAAAAGAATCTGCAGAAATGCCTGATGAT
GTTGACTTTAGGTTTAAAGTTCAGACAGATCTGTATGTTTTGGCACAAAATAAAGAAACT
CCGGTTAGTTTAACTATAAGTCCAAGTGGAAATCTATTTTGTATATACACAGCTTCAAGA
GTATTTAGAATATATAACTATAGTACAGGAAAAATTATGACAAAGTTTGAAGAAGCTTAT
GAGGATTATCAGGAAATACAAAACAATCCTAGTAGTGATTTAAGATTAGAAAGGATTGAG
TTTTATAGAAGAATTGCTTTAGAAAAAGATATGGATAAGAATTTAGAGAGGTTAAATGCA
GTGTGGGATGAAAGTGAAGAAATTATTATATACGCTGCGTATATTGGAATAAAATTCAGA
CTTGTAAGCACTGGGGAAGTTATCAGGATCATAGCTAAATCCGAGACCCCAAGGTTTACT
CAATTATTTTTGTATCAAGGAGTACCTATGCTTAACACCTCAGGCAAAGCTGGACTAGGT
GGGTCATCTTCCCAAGGTTTCAAAGAAATCGACCCGATAATATTTGCGATAGGATATCAT
AGGACACGTTTTTATTTATTTACAAAGAGAAACCCAGCTGATGAAGGAAAAGAAGATACA
AGAGATATAATGAATGAAACAATAACTGATGATAGTAAATGTTTAGTTATGCAACAAAAG
CCTTCTATAAGATTAGCTAAATCAGCAGTCATACATACAACAATGGGTGATATTACAATA
AAACTTTTCCCTAAACAGTGTCCAAGAACTGTAGAGAATTTTACAGGGCATTGTATGAAT
GGGTATTATTCACAACAGATTTTTCATAGGGTTATTAAAGGATTTATGATTCAGACTGGA
GACCCTGAAGGAAATGGGCATGGGGGAACTTCAATTTGGGGAGGGGAGTTTGAAGATGAA
ATATCTGAAGATTTAAAGCATGATAGACCTTTTACAGTATCTATGGCTAATCGTGGACCT
AATACTAATGGTTCACAGTTTTTTATTACAACTGTCGCTGCTTCTTGGCTTAATGGAAGA
CACACACTTTTTGGTAGGGTTGCCAAAGGAATGGATACTGTCTGTAGAATCGAAGGTGTC
CCATGTGATAAAAAGAATAAACCCAAAGCAGACATACGAATAGTTGATATTACAATTAAC
CTAGATTAA