Identifiers and Description

Gene Model Identifier

SteCoe_31228

Standard Name

None

Aliases

None

Description

RRM_1 domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Oxytricha TrifallaxContig18844.0.g1030.000000000000004658886145103398RNA recognition motif. (a.k.a.
RRM, RBD, or RNP domain)

Tetrahymena ThermophilaTTHERM_002484300.000000000005109089028063325RNA recognition motif-containi
ng protein
Saccharomyces CerevisiaeYNL110C0.00000001522997974471263Constituent of 66S pre-ribosom
al particles; involved in 60S
ribosomal subunit biogenesis;
localizes to both nucleolus an
d cytoplasm

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_31228(Protein)
MVKLLHSRLERFAKLRKLVPAAVNTHGYVYVSHMPAGLEEDGLRKFFNQFGKVTKVKVSR
SKKTGRSKSYSFVEFEEKEAAKIAAETMHGFLLFGKQLVCRYLDEVFKFTMFPNKRHVES
KYSQFKEKYNQEQSIEATKDRVFRLLDKEHKLREKISQSGVVYDFPGYESLVK


>SteCoe_31228(CDS)
ATGGTTAAGCTGCTGCACTCACGACTCGAACGCTTTGCTAAGCTTCGTAAGTTAGTCCCA
GCAGCTGTAAATACTCATGGTTATGTTTATGTGAGCCATATGCCAGCAGGTTTAGAAGAA
GATGGTCTACGCAAATTTTTCAATCAATTCGGCAAAGTGACAAAAGTCAAAGTATCTCGA
AGCAAAAAGACTGGCCGCTCAAAAAGTTATAGCTTTGTCGAATTTGAAGAAAAAGAAGCA
GCTAAAATCGCAGCGGAAACCATGCATGGGTTTCTTTTATTTGGTAAGCAGCTTGTTTGT
AGGTATTTGGACGAAGTATTCAAATTCACAATGTTCCCAAACAAAAGACACGTGGAAAGC
AAATATTCTCAGTTCAAAGAAAAATACAACCAAGAACAATCAATTGAAGCAACTAAAGAT
CGGGTGTTCCGCCTTCTTGACAAAGAGCACAAGCTAAGGGAAAAAATTAGCCAATCAGGA
GTTGTGTATGATTTCCCAGGATACGAAAGTTTAGTTAAATAA