Identifiers and Description

Gene Model Identifier

SteCoe_31246

Standard Name

None

Aliases

None

Description

hypothetical protein

Genome Browser

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Oxytricha TrifallaxContig2453.0.g798.75651076269652e-27WD domain, G-beta repeat

Tetrahymena ThermophilaTTHERM_001963801.9287498479639178e-22Intermediate chain subunit of
ciliary two-headed inner arm d
ynein (IAD) complex 1
WormBaseWBGene000159270.006737946999085467
Saccharomyces CerevisiaeYDR030C0.01831563888873418Protein involved in DNA repair
; related to the human CSA pro
tein that is involved in trans
cription-coupled repair nucleo
tide excision repair

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_31246(Protein)
MADKSDENSEKSEDISDHGESSGSLDDSNSNEFEVKDLIPQIIELNQETAAEVSYLTCLP
TRPLLTLRVSKKRRYFSQLMTKFNTTESPQSVEILHGRDPNFKKENFKQIIEIGLQAGCG
IKLIPTVKGTSFQSSFFNTSTKVCLYDRDDFIQQHKDNVAQISDVTEIPSIEHVIRNVEV
KIEEAIQSNETIDVFHDEFETLEAEKTDGSGNLANMINNTRTFSNLDYTKNKLVTDIQWE
PNKENVIAASCVENIKYEERVQRSGAYIPGSIIIWTFAEFNSVLCVLKAPLEITCFKFNP
YRPHIVVAGTISGQVCIWDTKLVKEKNRLEMLPKQDEAPELLILASSGIFDSHKGPVKSM
SWLPNQVKIERKNHCVVLNEPQEVSQFATLSEDGLILFWETSFPIDKNPYKNQDYVWQPL
LKVQITRIDTKADLGGTHLHINTVQKDSMFWATSDSGDLLLGDWVARSHDDSRPDXDFSI
FIYKNKYFL


>SteCoe_31246(CDS)
ATGGCAGACAAATCCGACGAGAACTCTGAAAAGTCAGAAGATATCTCAGATCATGGTGAA
TCCAGTGGAAGTCTTGACGATAGCAACAGCAACGAATTTGAAGTTAAAGACCTTATCCCA
CAAATCATCGAACTAAATCAAGAAACCGCAGCCGAAGTGAGTTATCTTACATGTCTTCCC
ACAAGGCCATTACTAACTCTTAGAGTCTCCAAAAAACGTAGATATTTTTCCCAACTAATG
ACCAAATTCAATACCACAGAATCCCCTCAGTCAGTAGAAATCCTCCATGGCCGCGACCCA
AACTTCAAAAAGGAAAATTTCAAACAAATCATCGAAATCGGTCTTCAAGCAGGATGTGGG
ATTAAACTTATCCCCACAGTCAAAGGAACAAGTTTCCAAAGTAGTTTTTTCAACACCTCA
ACCAAAGTTTGCCTTTATGACCGTGATGATTTTATCCAGCAGCACAAAGATAACGTCGCT
CAAATCTCAGATGTTACAGAAATCCCATCAATCGAACATGTGATTCGTAATGTTGAAGTC
AAAATCGAAGAAGCTATTCAATCTAATGAAACCATAGACGTCTTCCATGATGAATTCGAA
ACTTTAGAAGCAGAAAAAACTGATGGTAGTGGTAATTTGGCTAATATGATAAACAATACA
AGAACATTTTCTAATTTGGACTATACAAAAAATAAGCTTGTAACAGATATTCAATGGGAA
CCTAATAAAGAAAATGTTATCGCCGCAAGTTGTGTAGAGAATATAAAATATGAAGAACGT
GTGCAAAGATCAGGAGCATATATTCCAGGGAGTATTATAATATGGACATTTGCTGAATTT
AATAGTGTTTTATGTGTATTGAAAGCTCCATTAGAAATTACATGTTTTAAATTTAACCCT
TATAGACCACATATTGTTGTTGCAGGGACAATATCAGGACAAGTTTGTATATGGGATACA
AAGTTAGTAAAAGAAAAAAATAGACTTGAAATGCTACCTAAACAAGATGAAGCTCCTGAG
TTGTTGATATTAGCAAGTTCAGGGATTTTTGATTCACATAAAGGCCCAGTGAAATCAATG
TCTTGGCTACCGAATCAGGTGAAGATTGAGAGGAAAAATCATTGTGTTGTTTTGAATGAA
CCTCAGGAAGTCTCACAATTCGCCACACTTTCTGAAGATGGACTGATTTTGTTTTGGGAA
ACGAGCTTTCCTATTGATAAAAATCCTTATAAGAATCAAGATTATGTTTGGCAACCTTTG
CTTAAGGTACAAATTACGAGAATTGACACTAAAGCTGATCTTGGAGGTACACATTTACAT
ATAAATACTGTACAAAAAGACTCAATGTTTTGGGCTACTAGTGATTCTGGAGATTTACTT
CTTGGAGATTGGGTTGCTAGGTCACATGATGACTCCAGGCCGGACNATGATTTCTCTATT
TTTATATATAAAAATAAATATTTTTTATAG