Identifiers and Description

Gene Model Identifier

SteCoe_31394

Standard Name

None

Aliases

None

Description

LRR_9 domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Tetrahymena ThermophilaTTHERM_003286100.0000000000018795288165390832Leucine Rich Repeat family pro
tein
Oxytricha TrifallaxContig9263.0.0.g830.000000000005109089028063325Leucine Rich repeats (2 copies
)

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_31394(Protein)
MEGIIKQQVKGCDSEEVYELILDKYRGLSISLDEKLLLETFTNLESLSITGCGLKSLDNF
PALPKLLRLELCDNRLRNNLKSLLVLPSLTMLSLAGNQISSLEELEILSPLTNLASIDLF
NCPVTLVNGYSEKVFAMFKNLQVLDGVDKNGEEVSVASEDEEDEEEDDDDEDLNDFILYE
DDDDDVNDEPVKKSKINEDSDLEGDLKE


>SteCoe_31394(CDS)
ATGGAGGGTATCATAAAACAGCAAGTAAAAGGTTGTGATTCTGAAGAAGTCTATGAATTA
ATCCTCGATAAATACCGTGGCTTAAGTATTTCTTTAGACGAAAAACTTTTACTTGAGACT
TTTACAAATTTAGAATCTTTATCTATCACTGGATGTGGGCTTAAATCCTTAGATAATTTC
CCTGCTCTTCCTAAACTATTAAGACTAGAATTATGTGATAATAGACTAAGAAACAATTTA
AAATCTTTACTTGTCTTACCATCACTCACAATGCTTTCTCTTGCTGGCAATCAGATTTCC
TCATTAGAAGAATTAGAAATTTTATCCCCTTTAACCAATTTGGCAAGTATTGACTTGTTT
AATTGTCCAGTTACTTTAGTTAATGGGTATTCTGAAAAAGTTTTTGCTATGTTTAAAAAT
CTTCAAGTTCTTGATGGAGTTGATAAGAATGGAGAAGAAGTTTCTGTTGCTTCAGAAGAT
GAGGAAGATGAAGAAGAGGATGATGATGATGAAGATTTAAATGATTTTATTTTATATGAA
GATGATGATGATGATGTGAATGATGAACCGGTGAAGAAATCAAAGATTAATGAGGATAGC
GATTTAGAAGGTGATTTGAAGGAATAG