Identifiers and Description

Gene Model Identifier

SteCoe_31542

Standard Name

None

Aliases

None

Description

EF-hand_8 domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Oxytricha TrifallaxContig1726.0.g294.834541638053336e-68EF-hand domain pair

Tetrahymena ThermophilaTTHERM_002193502.506567475899953e-46EF hand family protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_31542(Protein)
MLFTNQQTQGGPRYSSKVLIGNWNEDVELEQVRFKDFLNKRETGALSINQVQGKVSKSMM
PVGHSFSQDGKLRFGDKIMLGNQKTRAFLACDLGDRIQSHEFGCAVTTSNSFQGPVARGV
FILTRVSQNDGFPSDYLHYGQEFTLTTHPKLWSSPLYLHSTVVSPFSFAKFSRYQEVCMH
SIRGPNTIWIAEHVDSKVRFESQGMPVAANSDVVIKHNQTGQWLSSDQINYRNDFGLDYE
VSCHSHLDTRKTQQLSSEKTGKITVDIPTRLQGLQNVWRIFTSERPECAEEKEEVLESSP
EVVLNSVKKILLERGAYGIRGLAKVFKNMDENGNRVLDPEDFKWGLYNYGIYLNENDIKT
LIKTFDRNSDGFVNFDEFLTTLKGKLNDRRLRLVALAYEKLDKNGDGQVTLDDIAKIYDA
SKHPEVRAGRLTEEQVFRQFITMWDTEKPDGIVTMKEFARYYEDVSASIDSDDYFEAMIR
SAWKL


>SteCoe_31542(CDS)
ATGTTGTTCACAAACCAGCAAACTCAAGGCGGGCCAAGGTATTCCAGCAAAGTTCTCATC
GGGAACTGGAATGAAGATGTAGAATTAGAACAGGTGCGTTTCAAAGACTTTTTAAATAAA
CGAGAGACTGGCGCTCTATCAATAAATCAAGTCCAAGGCAAAGTGTCTAAGTCTATGATG
CCAGTGGGCCATTCATTTTCCCAAGATGGGAAGCTTAGATTTGGTGACAAAATCATGCTG
GGAAACCAAAAAACACGAGCTTTTCTTGCTTGTGACTTAGGAGATAGGATCCAGTCTCAT
GAGTTCGGATGCGCTGTTACCACCTCAAATTCCTTCCAAGGCCCTGTTGCCAGAGGTGTT
TTTATACTAACAAGGGTATCACAGAATGATGGTTTTCCTAGTGATTATTTGCATTATGGG
CAGGAATTTACTCTTACTACTCATCCTAAGCTATGGAGTTCTCCTTTATATTTGCATTCA
ACTGTTGTCTCCCCTTTTAGTTTTGCCAAATTTTCTAGGTATCAAGAAGTATGTATGCAT
AGTATTAGAGGACCAAATACTATATGGATTGCTGAACATGTCGATTCAAAAGTTAGGTTT
GAAAGCCAGGGTATGCCTGTTGCAGCAAATTCTGATGTGGTGATAAAGCATAATCAAACT
GGACAATGGCTCTCATCTGACCAAATAAACTACCGCAACGACTTCGGCCTTGATTATGAA
GTAAGTTGCCACAGTCATTTAGACACCCGTAAAACCCAGCAACTAAGTTCAGAAAAAACC
GGGAAAATTACCGTCGATATCCCAACCAGACTCCAAGGTTTACAAAACGTCTGGAGGATT
TTCACTTCTGAAAGACCAGAATGTGCTGAAGAAAAAGAAGAAGTCCTAGAAAGTTCTCCT
GAAGTTGTCCTAAACTCAGTAAAAAAAATCCTTCTTGAAAGAGGAGCTTATGGTATCAGA
GGTCTAGCTAAAGTTTTTAAAAACATGGACGAAAATGGGAATAGAGTATTAGATCCTGAA
GATTTCAAATGGGGTTTATATAACTATGGAATCTATCTTAATGAAAATGATATAAAAACT
TTGATCAAAACTTTTGATAGGAATAGTGATGGTTTTGTGAACTTTGATGAGTTTTTGACT
ACACTTAAAGGAAAACTTAATGATCGCAGGCTTAGACTTGTAGCTTTAGCATATGAAAAA
CTTGATAAAAATGGTGATGGGCAAGTAACTTTAGATGATATTGCTAAGATTTATGATGCA
AGCAAACATCCTGAAGTACGTGCGGGTAGGCTTACTGAAGAACAGGTTTTTAGACAATTT
ATTACTATGTGGGATACTGAAAAACCTGATGGAATTGTTACGATGAAAGAATTTGCCAGA
TATTATGAAGATGTTAGTGCTAGTATTGATTCTGATGATTACTTTGAAGCTATGATTAGA
AGTGCTTGGAAACTTTAA