Identifiers and Description

Gene Model Identifier

SteCoe_31554

Standard Name

None

Aliases

None

Description

Hist_deacetyl domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
WormBaseWBGene000018361.0927656633766312e-73
Oxytricha TrifallaxContig1866.0.g685.96629836401057e-72Histone deacetylase domain

Saccharomyces CerevisiaeYNL330C6.542840619051457e-69Histone deacetylase, component
of both the Rpd3S and Rpd3L c
omplexes; regulates transcript
ion, silencing, autophagy and
other processes by influencing
chromatin remodeling; forms a
t least two different complexe
s which have distinct function
s and members; Rpd3(L) recruit
ment to the subtelomeric regio
n is regulated by interaction
with the arginine methyltransf
erase, Hmt1p
Tetrahymena ThermophilaTTHERM_005026102.8946403116483003e-63Histone deacetylase family pro
tein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_31554(Protein)
MSERRVAYFYDENIGNYYYGQGHPMKPHRVRMTHQLILGYKLYRSMDVYRPHYATPEELM
QFHTADHIKFLQKAEISGERLFTHYERAREDCPVFENMFEFSQICAGASIDCAQILNQGE
ADIAVNWSGGFHHAKKGEASGFCYINDIVLAILELLKYHERVLYLDIDAHHGDGVEEAFY
TSNRVMTVSFHKFGNFFPGTGDIKDCGAGSGKYHCLNIPLKSGMTDECYERIFEPIMREV
VYHFQPNALVMQCGSDSLAHDKLGKFNLTLRGHGHCIKFMKEFGLPMMVIGGGGYTVANV
ARCWAYETGIVLGKDIENEIPSNDYYQYYGPSYNLHIEPDKNLENRNQRDYLETAMIRCL
ENIRRLEGAPSVQRQDIPPDFFPSEFREKIRSRETVLEYEE


>SteCoe_31554(CDS)
ATGTCAGAACGTAGAGTCGCATATTTTTACGATGAGAATATAGGAAACTATTATTATGGA
CAAGGACACCCAATGAAACCTCACAGAGTTCGAATGACTCATCAGCTTATTCTCGGTTAC
AAATTATATAGATCAATGGATGTTTATCGACCTCATTATGCAACACCAGAAGAACTTATG
CAATTCCACACAGCAGACCATATAAAATTCCTTCAAAAAGCTGAGATTTCAGGAGAAAGG
CTTTTTACTCATTATGAACGAGCTCGTGAAGATTGTCCAGTATTTGAGAATATGTTTGAA
TTCTCACAGATTTGCGCTGGAGCTTCAATTGACTGTGCCCAAATCTTAAATCAAGGAGAA
GCTGATATCGCTGTTAATTGGTCAGGGGGATTTCATCATGCAAAAAAAGGTGAGGCTTCA
GGCTTTTGCTATATAAACGATATTGTCTTAGCGATATTAGAACTTCTCAAATATCATGAG
AGAGTTTTGTATTTAGATATAGATGCGCATCATGGTGATGGAGTTGAAGAAGCTTTCTAC
ACATCAAATCGAGTAATGACTGTATCCTTCCACAAATTCGGTAACTTTTTCCCAGGGACT
GGGGATATAAAAGACTGTGGAGCAGGTTCAGGAAAATACCATTGTTTAAATATCCCATTG
AAATCCGGGATGACAGACGAATGTTATGAAAGGATTTTTGAGCCAATAATGCGAGAAGTT
GTCTATCATTTCCAACCAAATGCTTTAGTAATGCAATGTGGAAGTGATTCTTTAGCCCAT
GATAAACTTGGTAAATTTAACCTAACACTTCGAGGTCATGGTCATTGTATAAAATTCATG
AAAGAATTCGGTTTACCAATGATGGTAATTGGAGGTGGTGGTTATACTGTAGCAAATGTT
GCAAGATGTTGGGCTTATGAAACTGGTATAGTTCTAGGAAAAGATATAGAAAATGAAATC
CCATCAAATGATTATTATCAATATTATGGACCTTCTTATAATCTTCATATTGAACCTGAT
AAAAATTTAGAGAATAGGAATCAAAGGGATTATTTAGAAACTGCAATGATAAGATGTTTA
GAAAATATTAGAAGATTAGAAGGAGCACCAAGTGTACAGAGACAAGATATACCACCAGAT
TTCTTTCCTAGTGAATTTAGAGAGAAAATACGTAGTAGGGAGACGGTTTTAGAATATGAA
GAATAG