Identifiers and Description

Gene Model Identifier

SteCoe_31581

Standard Name

None

Aliases

None

Description

CBM_48 domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Oxytricha TrifallaxContig22093.0.g310Alpha amylase, C-terminal all-
beta domain

WormBaseWBGene000114090

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_31581(Protein)
MEAILHRGLFKVVVEDPSLQGFNDQIKSRFERFQRKKREIQQAEGSLTNFALGYKKFGLH
ATTKGIIYREWAPGAESLYLFGDFNNWQRRQYMCERNEFGVWTVLIPNTKDGFAIKHGSR
VKCGVRIRGQDEDRIPAWISYAIPSSSKLYDGVYWNPPEPYEFKYPRPEYPISLRIYECH
IGMSSEHGIVNSYKDFMINVLPKIAEAGYTAIQFMAIMEHAYYGSYGYHVTNFFAVSSRY
GNPEELKELIDMGHKYGIYMLLDVVHSHASMNVLDGLNKFDGTDHHYFHEGKQGIHELWD
SRLFNYSSWEVLRFLLSNLRWYLEEYQFDGFRFDGVTSMLYKHHGVKFVFSGQYHEYFSQ
NAVDMDAHVYLMLANDLVHQLYPDVITLAEDVSGMPTLCRPIYEGGFGFDYRFNMSIPDK
WIQLLKEVKDENWPMANIVYTLTNRRWNEKCVAYVESHDQSIVGDKTLAMWLFDKEIYTN
MSKKTPLTATVHRGLGLHKMIRLITQALGGEAYLTFMGNEFGHPEWVDFPREGNGWSHHH
CRRQWHLRDDPQLHYHDLWLFDKAMNDLETEYRWLASKEHYITLTHEKDKIIIFEHGMLV
FVFNFHPTKSFEHYRVGTKWPYEHLIVLDTDEQRFGGLERLRHGHDNPFPIMREGWCGRP
NYIQMYIPSRTAIVLKPLIIEQKSKEEEEEDQEGYEEIEKKEEDKNEEDKEEDKNEEDEE
EDKESEESKEKIVGKIIIEDEKREKKRLGEEEEKSKRFEEKKKVEEKKKVEEGMKKKTEE
MKKKKEDEVKRKEKETVAMKESEDGKNVQNLPKKSPTKPSTETVVLFSSDS


>SteCoe_31581(CDS)
ATGGAAGCTATTTTACATAGAGGGCTTTTCAAGGTCGTAGTCGAAGACCCATCTTTGCAA
GGCTTCAACGATCAAATCAAATCAAGATTCGAAAGGTTCCAAAGGAAAAAACGTGAAATA
CAACAAGCAGAAGGTTCATTGACGAACTTTGCTTTAGGGTATAAGAAATTTGGTTTACAT
GCAACAACAAAAGGGATAATATATCGTGAATGGGCTCCAGGAGCTGAATCATTATATTTG
TTTGGTGACTTCAATAATTGGCAACGTAGACAATACATGTGTGAAAGAAATGAATTTGGT
GTGTGGACTGTGTTGATTCCAAACACAAAAGATGGTTTTGCTATAAAACATGGGTCTAGG
GTGAAATGTGGAGTTAGAATTAGAGGTCAAGATGAAGACCGAATCCCAGCTTGGATTTCT
TATGCTATTCCAAGTTCTTCTAAGTTATATGATGGAGTATATTGGAATCCTCCTGAACCT
TATGAGTTTAAATATCCTCGTCCTGAGTATCCAATAAGTTTACGTATTTATGAGTGTCAT
ATAGGTATGAGCTCAGAGCATGGTATTGTAAATAGCTATAAAGACTTTATGATAAATGTC
TTACCAAAAATAGCTGAGGCTGGTTATACAGCTATACAATTCATGGCAATAATGGAACAT
GCTTATTATGGTTCATATGGTTATCATGTGACTAATTTTTTTGCTGTTAGTAGCAGATAT
GGTAATCCTGAAGAACTTAAAGAACTTATTGACATGGGTCATAAATATGGGATTTATATG
CTTTTAGATGTTGTTCATAGTCATGCTAGTATGAATGTCCTTGATGGTTTGAATAAATTT
GATGGTACTGATCATCATTATTTCCATGAAGGTAAACAAGGAATACATGAACTTTGGGAT
TCAAGGCTTTTTAATTACTCATCTTGGGAAGTATTAAGATTTCTTCTATCAAATTTACGA
TGGTATTTAGAAGAGTATCAATTTGATGGGTTTAGATTTGATGGAGTTACTTCGATGCTA
TATAAACATCATGGGGTCAAGTTTGTGTTTTCAGGACAATATCATGAGTATTTTAGTCAG
AATGCAGTTGATATGGATGCTCATGTTTATTTAATGTTGGCTAATGATTTAGTACATCAG
TTATACCCAGATGTTATAACCTTAGCTGAAGATGTTTCTGGAATGCCAACTTTATGTAGG
CCTATATATGAAGGAGGTTTTGGTTTTGATTATCGTTTTAATATGTCGATACCAGATAAA
TGGATACAATTACTTAAGGAAGTTAAGGATGAAAACTGGCCTATGGCAAATATTGTATAT
ACATTAACGAATAGAAGATGGAATGAAAAATGTGTCGCTTATGTTGAAAGTCATGATCAA
AGCATTGTTGGAGATAAAACCTTAGCTATGTGGCTTTTTGATAAAGAAATTTATACTAAC
ATGTCTAAAAAAACTCCACTTACTGCAACGGTTCATCGTGGACTTGGTTTACATAAAATG
ATCAGGCTTATAACCCAAGCTTTAGGTGGTGAAGCGTATTTAACTTTTATGGGAAATGAA
TTTGGTCATCCAGAATGGGTTGATTTTCCTAGAGAAGGTAATGGCTGGTCACATCATCAT
TGCCGTAGACAATGGCATTTAAGAGATGATCCTCAATTACATTATCATGATTTATGGTTA
TTTGATAAAGCTATGAATGATTTAGAAACTGAATATCGATGGCTTGCTAGTAAAGAACAT
TATATCACTTTGACTCATGAAAAAGATAAAATTATTATTTTTGAACATGGGATGCTTGTG
TTTGTGTTTAATTTTCATCCGACTAAAAGCTTTGAACATTATAGAGTTGGGACAAAATGG
CCTTATGAACATTTGATTGTCTTAGATACTGATGAACAAAGATTTGGTGGATTGGAAAGG
TTAAGACATGGACATGATAATCCATTTCCTATTATGAGAGAAGGATGGTGTGGAAGACCT
AATTATATACAGATGTATATACCTAGTAGGACTGCGATTGTGCTAAAACCATTGATTATT
GAACAAAAATCTAAGGAAGAGGAAGAGGAAGATCAGGAGGGATATGAAGAAATTGAGAAA
AAAGAAGAAGATAAAAATGAAGAGGATAAGGAGGAAGATAAGAATGAAGAGGATGAGGAA
GAAGATAAGGAAAGTGAAGAAAGTAAAGAGAAAATTGTTGGAAAAATAATTATTGAAGAT
GAAAAAAGGGAAAAAAAGAGGTTAGGGGAAGAGGAAGAGAAGAGTAAAAGGTTTGAGGAG
AAGAAAAAAGTTGAGGAGAAAAAAAAAGTTGAGGAGGGGATGAAGAAAAAAACGGAGGAA
ATGAAGAAGAAAAAGGAGGATGAAGTTAAGAGGAAAGAGAAAGAGACAGTGGCTATGAAA
GAGAGTGAGGATGGGAAAAATGTGCAGAATTTACCGAAGAAAAGTCCAACTAAACCGTCA
ACAGAGACTGTTGTGCTTTTTAGTTCAGATAGTTAA