Identifiers and Description

Gene Model Identifier

SteCoe_31620

Standard Name

None

Aliases

None

Description

Clat_adaptor_s domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Oxytricha TrifallaxContig21523.0.g450Adaptor complexes medium subun
it family

WormBaseWBGene000068290
Tetrahymena ThermophilaTTHERM_011086201.3485799642996046e-77homolog of adaptor protein com
plex (AP-1) medium (mu) subuni
t; localized to internal struc
tures in cell
Saccharomyces CerevisiaeYPL259C2.8946403116483003e-63Mu1-like medium subunit of the
AP-1 complex; binds clathrin;
involved in clathrin-dependen
t Golgi protein sorting; the A
P-1 complex is the clathrin-as
sociated protein complex

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_31620(Protein)
MGYGPSGVYILDMKGKTIIYRAYRRDAPAATTVSDRFTRLVLEAEEETIKPVFQHNDINY
MWIKYNNLFIVGTSVLNANAMMVFTFLYKLAEVLSLYFRELEEESIKDNFVVTYELLDEM
IDNGYPQTTEYKVLKEYIKSESHQLAENTQLAVPISVSNAVSWRDDGLKYKKNEVFLDVI
EKLNLLVASNGNVLKSEILGNLKMRCMLSGMPELKLGLNDKLLFEATGRQTRGKAVELED
IRFHQCVRLARFENDRTISFIPPDGEFELMSYRLNTHVKPLIWVESRIEHFSTSRLELIV
KAKSQFKSRSIANNVQIIVPVPSDASSPVFKTTIGVVKYEPSQDAVVWTLKQFQGQKEYI
LRISLSLPVVMSSDRNHFQKIPIRLVFEIPYFTVSGIQVRYLKIIEKSGYQALPWVRYIT
QNGDYQIRIL


>SteCoe_31620(CDS)
ATGGGATACGGACCATCAGGTGTTTATATCCTTGACATGAAAGGTAAAACAATAATTTAC
AGAGCCTATCGACGTGATGCACCTGCAGCTACAACAGTTTCAGACCGTTTCACAAGACTT
GTCCTAGAAGCTGAGGAAGAAACTATCAAGCCTGTTTTTCAACATAATGATATCAATTAT
ATGTGGATAAAATACAATAATCTCTTTATTGTTGGGACAAGTGTTTTAAATGCTAATGCT
ATGATGGTCTTCACATTCCTTTACAAGCTTGCCGAAGTTCTTTCTCTCTATTTCCGTGAA
CTCGAAGAAGAGAGTATCAAAGACAATTTTGTCGTGACTTATGAGTTATTAGATGAAATG
ATAGATAATGGATATCCGCAAACAACAGAATATAAGGTTTTAAAAGAATATATAAAAAGT
GAATCTCATCAATTAGCAGAAAATACTCAATTAGCAGTTCCAATATCAGTGTCAAATGCA
GTATCATGGCGAGATGATGGGTTAAAATATAAGAAAAACGAAGTTTTTCTTGATGTTATA
GAAAAACTAAATTTACTCGTAGCATCAAATGGTAATGTCCTAAAATCAGAAATCCTTGGA
AACTTAAAAATGCGTTGTATGCTAAGTGGAATGCCTGAACTTAAACTTGGGCTTAACGAT
AAACTTCTTTTTGAAGCTACAGGTCGACAAACACGTGGTAAAGCTGTTGAATTAGAAGAC
ATTCGTTTTCATCAATGTGTCCGACTTGCCCGTTTTGAAAATGATAGGACAATAAGTTTT
ATACCCCCAGATGGAGAATTTGAACTTATGTCATATAGACTTAATACTCATGTTAAACCT
TTAATATGGGTTGAGTCTAGAATTGAACATTTTAGTACATCTAGACTTGAACTTATAGTA
AAAGCTAAATCACAGTTTAAATCTAGATCTATTGCTAATAATGTTCAAATTATTGTCCCT
GTACCAAGTGATGCTTCTAGTCCAGTTTTTAAAACCACAATTGGTGTTGTTAAATATGAA
CCTTCACAAGATGCGGTTGTTTGGACACTTAAACAGTTTCAAGGACAGAAAGAATATATT
TTAAGGATTTCACTTAGTCTTCCTGTTGTTATGTCTTCAGATAGGAATCATTTTCAGAAA
ATCCCGATAAGACTTGTGTTTGAAATACCTTATTTTACGGTTTCGGGAATACAGGTTAGA
TATTTGAAGATTATTGAGAAGTCTGGATATCAAGCTTTACCTTGGGTTAGATATATTACT
CAGAATGGTGATTATCAAATTAGGATTCTTTAG