Identifiers and Description

Gene Model Identifier

SteCoe_3215

Standard Name

None

Aliases

None

Description

HMG-CoA_red domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Tetrahymena ThermophilaTTHERM_006911802.3455513385429143e-59Putative Hydroxymethylglutaryl
-CoA reductase
Oxytricha TrifallaxContig20054.0.g969.462629465836378e-57Hydroxymethylglutaryl-coenzyme
A synthase C terminal

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_3215(Protein)
MQRYLFDFHKKTIQERMQILQLLYPQMNGSYNEGMDLKTADLMIENCIGKMSLPVGLGLN
FLINSKEYIVPMSTEEPSIVAAASAAAKFIKEHGGFKASCTAPLMIGQIQILDIDCIEFN
QSLQEKKLSLIKQANTLYCQRMVARGGGVTDLNFQSLSQTSGVVEIKVNVGEAMGANIVN
TICEGLAGDLIKLFPCRIGLKILSNFCTERRVISEYKIPLDKLTYKNLSSQDISKGFIES
YDFARQSVYRACTHNKGILNGMQAVGVATGQDTRAIEAAAHTWASRSGKYQPLNDYYIED
NYLIGRIELPMAVGTKGGALRTNPSYVSSAYILGHPSSSELAMIIASVGLACNFAAIRAM
VSEGIQKGHMGLHAKNIAIAVGVPNEIVQEVVEYMKQRGNISQQTALDYLAAHHLHAKSR
KKYTITASLNTFYANFPDCTPPLKLSIAFHCPKIHGMHIVIDKNPQNDASKIHSLLFSRS
SYTWVTSFLSMLNQIRFHPRLPRTNKELQIKMKLLCIWLNEILINLIVSWGSEKSEKAIE
AILDGNVSSIEHIVSGSEEYVEYGVYLVMELWHILNYHLDAFVTAALPCSDTLANAIRDE
IRKVLKGNLKASCGKMKDFAELLMYRKKQMCATLMYLCDCLGEAKIDLELIEELMQVGEV
LEILSSARRDFNKVFKGDRTNPNLYACWSSLNGNNPAKYFDHFNELVKNQTKNFNTTQMS
LIKKAESLLNVYYDIAPKL


>SteCoe_3215(CDS)
ATGCAGCGATATCTGTTTGACTTCCACAAGAAAACCATTCAGGAACGCATGCAAATCCTT
CAATTGCTATACCCACAGATGAACGGGTCTTACAATGAAGGTATGGATTTAAAAACAGCT
GATCTTATGATAGAAAATTGTATTGGCAAAATGAGTTTGCCTGTTGGTCTCGGTCTAAAC
TTCCTTATAAATTCTAAAGAATATATTGTCCCAATGAGTACAGAAGAGCCTTCTATAGTT
GCTGCAGCATCAGCTGCAGCCAAGTTTATTAAAGAGCATGGGGGATTTAAAGCTTCATGT
ACTGCCCCATTGATGATTGGACAAATACAAATTCTTGATATAGACTGTATAGAATTTAAT
CAAAGTTTACAAGAAAAGAAATTATCTTTGATAAAACAAGCAAATACCTTATATTGTCAA
AGAATGGTAGCAAGAGGAGGAGGTGTTACTGATTTAAATTTTCAATCATTATCCCAAACA
AGTGGCGTAGTTGAAATCAAAGTTAATGTTGGTGAAGCTATGGGGGCAAATATCGTAAAC
ACAATCTGTGAAGGCCTAGCTGGGGACCTTATAAAACTTTTCCCATGCCGAATCGGTTTA
AAAATCCTATCTAACTTCTGTACAGAAAGACGAGTAATAAGTGAATATAAAATCCCTTTA
GACAAATTAACTTATAAAAACCTAAGCAGCCAAGATATATCAAAAGGTTTTATTGAAAGC
TATGATTTTGCAAGACAAAGTGTATATCGAGCATGTACACATAACAAAGGTATATTAAAT
GGTATGCAAGCTGTAGGTGTAGCAACAGGACAAGATACAAGGGCAATAGAAGCAGCGGCT
CATACATGGGCAAGTCGAAGTGGTAAATATCAGCCTTTAAATGATTACTATATAGAAGAT
AATTATCTTATAGGCCGTATAGAATTACCTATGGCTGTTGGGACAAAAGGTGGTGCTTTA
AGAACAAATCCATCATATGTGAGTTCAGCATATATACTTGGTCATCCATCATCATCTGAA
TTGGCAATGATAATAGCAAGTGTTGGTTTAGCATGTAATTTCGCAGCTATAAGGGCAATG
GTTTCTGAAGGTATTCAAAAAGGTCATATGGGTCTTCATGCTAAAAATATAGCAATAGCA
GTTGGTGTACCTAATGAAATTGTTCAAGAAGTTGTTGAATATATGAAACAAAGGGGGAAT
ATAAGCCAACAAACCGCTTTAGACTACCTTGCAGCACATCATTTGCATGCTAAATCTAGG
AAAAAATATACTATTACAGCGTCTTTAAATACTTTTTATGCAAATTTCCCTGATTGTACA
CCTCCTTTAAAGCTCAGTATTGCTTTTCATTGCCCTAAAATACATGGAATGCATATTGTT
ATAGATAAAAATCCACAAAATGATGCATCTAAAATACATAGTTTACTGTTTTCTAGAAGC
AGTTATACTTGGGTTACATCATTTCTTTCAATGCTTAATCAGATAAGATTTCACCCAAGG
CTACCAAGGACGAATAAAGAATTACAGATAAAAATGAAACTTCTTTGTATTTGGCTTAAT
GAGATATTGATAAATCTTATTGTATCGTGGGGATCAGAAAAATCAGAAAAAGCTATTGAA
GCAATTTTAGATGGGAATGTGTCAAGTATTGAACATATTGTTAGTGGAAGTGAAGAATAT
GTGGAATATGGGGTGTATTTAGTAATGGAACTTTGGCATATTTTGAATTATCATTTAGAT
GCTTTTGTTACGGCTGCTTTGCCATGCTCGGATACTTTGGCTAATGCAATTAGAGATGAG
ATTAGAAAAGTACTTAAGGGTAATCTAAAAGCTTCTTGTGGGAAAATGAAAGATTTTGCT
GAACTTTTAATGTATAGGAAGAAACAAATGTGCGCAACTCTTATGTATCTTTGTGACTGC
TTAGGGGAAGCGAAAATTGATTTAGAACTTATTGAGGAATTGATGCAAGTTGGGGAAGTA
CTTGAGATATTAAGTTCAGCAAGAAGGGATTTCAATAAAGTTTTTAAAGGGGATAGAACA
AATCCTAATCTTTATGCTTGCTGGTCATCATTAAATGGGAATAACCCAGCTAAGTATTTT
GACCATTTTAACGAACTTGTGAAAAACCAGACAAAGAATTTCAACACAACGCAGATGAGT
CTTATAAAGAAAGCTGAAAGTTTGTTAAATGTTTATTACGATATTGCTCCTAAGTTATAG