Identifiers and Description

Gene Model Identifier

SteCoe_32369

Standard Name

None

Aliases

None

Description

Ras domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Tetrahymena ThermophilaTTHERM_010855503.0144087850653746e-40Ras family protein
Oxytricha TrifallaxContig9539.0.g561.8048513878454153e-35Ras family

Saccharomyces CerevisiaeYOR185C0.00000000000003442477108469977GTP binding protein (mammalian
Ranp homolog); involved in th
e maintenance of nuclear organ
ization, RNA processing and tr
ansport; interacts with Kap121
p, Kap123p and Pdr6p (karyophi
lin betas); not required for v
iability; protein abundance in
creases in response to DNA rep
lication stress; GSP2 has a pa
ralog, GSP1, that arose from t
he whole genome duplication
WormBaseWBGene000042680.00000000000009357622968840175

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_32369(Protein)
MDHLIESKVKQASELAPCDVKIILLGDSAVGKSKLVERFLINDYEERQLSTYALTMFRHT
TNFEGQELKIDIWDTAGQECFNNLHPSFYFGAHACILVFDVTRKLTYANLKNWYKEMRAY
CPDIPCVLIANKIDVNMDVTKKSFKFGEQYGLDFHFVSAADGTNVVKIFRETLGKALEFK
RNPPRSFERDVMELLDDDSWLNS


>SteCoe_32369(CDS)
ATGGATCATCTCATCGAAAGCAAAGTCAAACAAGCATCTGAGTTAGCTCCATGTGATGTG
AAAATCATATTACTAGGAGACTCTGCTGTTGGCAAGTCCAAACTAGTTGAAAGATTCCTT
ATAAACGACTACGAAGAACGTCAACTTTCGACCTATGCTCTGACAATGTTCAGACATACT
ACAAACTTCGAAGGTCAAGAGCTAAAAATCGATATCTGGGACACAGCAGGCCAAGAATGC
TTTAATAATTTGCATCCATCTTTTTATTTTGGTGCTCATGCTTGCATTCTAGTATTTGAC
GTGACCAGAAAATTAACATATGCCAACTTGAAAAATTGGTATAAAGAAATGAGAGCATAT
TGTCCTGATATACCTTGTGTATTAATTGCTAACAAAATTGATGTGAATATGGATGTTACA
AAGAAAAGTTTTAAGTTTGGAGAACAGTATGGACTTGATTTTCATTTTGTATCAGCTGCA
GATGGGACTAATGTTGTGAAGATATTTAGAGAAACATTAGGGAAAGCATTGGAGTTTAAG
AGAAACCCCCCAAGGAGTTTTGAGAGGGATGTGATGGAGCTTTTAGATGATGATTCATGG
TTGAATAGTTAG