Identifiers and Description

Gene Model Identifier

SteCoe_32375

Standard Name

None

Aliases

None

Description

UPF0020 domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Oxytricha TrifallaxContig10438.0.g733.975449735908647e-31Putative RNA methylase family
UPF0020

Tetrahymena ThermophilaTTHERM_000519701.9287498479639178e-22homolog of the catalytic subun
it of S. cerevisiae tRNA methy
ltransferase
WormBaseWBGene000221072.3195228302435696e-16
Saccharomyces CerevisiaeYOL124C0.000000000000001713908431542013Catalytic subunit of adoMet-de
pendent tRNA methyltransferase
complex; required for the met
hylation of the guanosine nucl
eotide at position 10 (m2G10)
in tRNAs; contains a THUMP dom
ain and a methyltransferase do
main; another complex member i
s Trm112p

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_32375(Protein)
MGKFLCSIITKPRLQEFSISELISLSSLYNIPTQDLFSHYNFSFSTDQEYTDYFLKAIEH
NPFIYTNIPSSDICKKIASRSICTERFTYHISHGDSIETLISNTINEYNSNLEIKDIISA
DTPFEFRFDTYLQKISQEQKQAIIQAFAPVPFRGKVELKSPERTFIVSICAGNMYFGLEV
ARSKIKRTCFYSKYNLAEREYLGPTTTDIELALLMVNQGQVVENSLVLDPFVGTGGILLA
ASVFGGVCYGGDIDMRVLKGLGVGRSTKNTQADIFTNFSNYGFKKPEILRCDNSTPCLRP
INFFDCLICDPPYGVRAASRKTHKNTTEVYEGTKVFYDLLDFAAGMLRIGGRLVYLLPTE
RKLYDPLGLPKHPLLKIVANSENVLSRKISRRLITMERVGNAEGCDDENQKGFYQDIRTT
WFRKEMR


>SteCoe_32375(CDS)
ATGGGAAAGTTCTTATGCAGCATAATAACAAAGCCAAGGCTTCAAGAATTCAGTATATCC
GAGCTGATTTCTTTAAGCAGCCTTTACAATATACCTACTCAAGACCTTTTTTCCCATTAC
AACTTTTCATTCAGTACAGATCAGGAATACACTGATTATTTCCTCAAAGCAATCGAACAT
AATCCATTCATATATACCAACATACCATCTTCTGATATATGTAAAAAAATCGCATCTAGA
TCTATTTGTACAGAAAGGTTCACATATCATATATCTCATGGTGATTCAATAGAAACTTTA
ATCTCAAATACTATAAACGAATACAATTCTAACTTAGAAATTAAAGATATTATATCAGCA
GATACACCTTTTGAGTTTAGATTTGACACTTATTTGCAAAAAATATCCCAAGAACAGAAA
CAAGCTATAATTCAAGCTTTTGCCCCTGTACCGTTTAGAGGAAAGGTTGAGTTAAAATCC
CCAGAGAGAACGTTTATTGTGTCGATATGTGCGGGAAATATGTATTTTGGTTTAGAAGTT
GCTAGGTCTAAAATCAAAAGAACGTGTTTTTATAGTAAATATAATTTGGCTGAAAGGGAA
TATTTAGGCCCTACAACAACGGATATTGAGCTAGCATTACTTATGGTAAACCAGGGGCAG
GTTGTTGAGAATTCATTAGTTTTAGACCCTTTTGTTGGGACTGGGGGTATTTTACTAGCT
GCTTCAGTGTTTGGAGGAGTTTGTTATGGCGGAGATATCGACATGAGAGTTCTTAAAGGT
CTTGGTGTTGGCCGCTCAACAAAAAACACCCAAGCCGACATTTTCACTAATTTCTCTAAT
TACGGGTTTAAAAAGCCAGAAATTCTCCGTTGTGACAATTCTACTCCATGCTTAAGACCA
ATAAATTTCTTTGATTGCCTTATTTGTGATCCTCCTTATGGTGTTAGAGCTGCATCTAGA
AAAACACATAAAAATACAACAGAAGTATATGAAGGAACAAAAGTTTTTTATGATTTATTA
GATTTTGCTGCTGGTATGCTAAGAATTGGAGGAAGATTAGTATATTTACTACCAACTGAA
AGGAAACTTTATGATCCGTTAGGACTTCCAAAGCATCCCTTGTTGAAAATTGTGGCAAAT
AGTGAAAATGTTCTTTCTAGAAAAATATCGAGGAGGCTGATTACTATGGAAAGGGTTGGT
AATGCTGAAGGATGTGATGATGAGAATCAGAAAGGGTTTTATCAGGATATTAGGACGACT
TGGTTTAGAAAAGAAATGAGATAA