Identifiers and Description

Gene Model Identifier

SteCoe_32377

Standard Name

None

Aliases

None

Description

Ribosomal_S6e domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Oxytricha TrifallaxContig14465.0.g801.1089390193121365e-40Ribosomal protein S6e

Saccharomyces CerevisiaeYPL090C6.639677199580735e-36Protein component of the small
(40S) ribosomal subunit; homo
logous to mammalian ribosomal
protein S6, no bacterial homol
og; RPS6A has a paralog, RPS6B
, that arose from the whole ge
nome duplication
Tetrahymena ThermophilaTTHERM_001497981.8048513878454153e-35Homolog of yeast RPS6, human R
PS6;

WormBaseWBGene000044757.281290178321643e-33

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_32377(Protein)
MKFNISFPETGQQKCIDIEDDKKVRLFYDRKMGEEVDGAALGDEFKGYVFRIAGGNDKQG
FSMKQGVLVNKRVRLLLAAGHTNYRPRRTGERKRKSVRGCIVGHDIAVLHLVVIKKGTNE
IPGVTDDPRPRRLGPKRASKIKKLFSLDKGVNKKEKKAEERDDVRRYVVKREIKKEGKST
RLRAPKIQRLITAERIRRKMKEKTEKKNRWTRAKEEAKKYNTLLNKVLHQRHVEEHKLRE
AAKSS


>SteCoe_32377(CDS)
ATGAAGTTCAACATCTCGTTTCCAGAAACAGGTCAGCAAAAATGCATAGACATTGAAGAT
GATAAAAAAGTCAGGCTTTTTTACGACCGCAAAATGGGTGAAGAAGTTGATGGAGCAGCC
CTCGGCGACGAGTTCAAAGGCTACGTATTTAGGATTGCTGGTGGAAATGACAAGCAAGGT
TTTTCCATGAAACAAGGAGTTCTGGTCAACAAACGTGTAAGACTTCTCCTGGCTGCAGGT
CATACAAACTATCGTCCCAGAAGAACTGGTGAAAGGAAAAGAAAATCAGTTAGAGGTTGT
ATTGTAGGACATGATATCGCTGTTTTACATTTAGTAGTTATAAAGAAAGGTACAAATGAA
ATCCCAGGTGTTACTGATGACCCTAGACCTAGAAGACTTGGCCCTAAGCGAGCTAGTAAA
ATCAAAAAACTCTTTTCATTAGACAAAGGAGTTAATAAGAAAGAGAAAAAAGCTGAGGAA
AGAGATGATGTTAGGAGATATGTTGTTAAAAGGGAGATTAAAAAAGAAGGGAAATCAACA
AGACTTAGGGCACCAAAGATACAAAGGCTTATAACTGCTGAGAGGATTAGAAGAAAAATG
AAGGAAAAAACTGAAAAGAAAAACAGGTGGACTAGAGCTAAGGAAGAAGCTAAGAAATAT
AATACACTGCTTAATAAAGTCCTTCATCAAAGACATGTTGAAGAACATAAACTTAGAGAA
GCAGCTAAAAGTTCATAA