Identifiers and Description

Gene Model Identifier

SteCoe_32382

Standard Name

None

Aliases

None

Description

Mito_carr domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Oxytricha TrifallaxContig20765.0.g624.906094730649281e-35Mitochondrial carrier protein

Tetrahymena ThermophilaTTHERM_004746704.780892883885469e-25Mitochondrial carrier protein
Saccharomyces CerevisiaeYPR011C2.1151310375910805e-19Mitochondrial transporter; maj
or substrates are adenosine 5'
-phosphosulfate (APS) and 3'-p
hospho-adenosine 5'-phosphosul
fate (PAPS); member of the mit
ochondrial carrier family; the
authentic, non-tagged protein
is detected in highly purifie
d mitochondria in high-through
put studies
WormBaseWBGene000100778.533047625744066e-17

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_32382(Protein)
MKKPEHVYTVPLAQPIPSNSDLSWHLLTGVKFTQGISGGISRTVTSPLERLKILRQCSST
EYNGLSFWQSMKKFNDLEGFRGFFKGNGSNIIRIVPFSALEFYAFEKAKYSLLPSDNPRH
KGWLLICGSISGIVASFCTYPLDLVRTILSINVDRGGSGIAKETVRIFKSEGVFGLYKGL
NMTLFGIAPFIGIKMSTFDILKARYLQDPKDKNIGKKTLVLGGVAGAVATALTYPTDLLR
RKMQLITYNKNLETPYKNIFQCIRWIYINEGIPGFYKGLVPCFAKVIPAMAVAFAVNEEL
KKLFNVRSS


>SteCoe_32382(CDS)
ATGAAAAAGCCGGAGCATGTTTATACAGTTCCTTTAGCACAGCCTATTCCTTCAAATAGT
GATCTTTCTTGGCATTTATTGACAGGGGTAAAATTTACACAGGGAATCTCAGGAGGAATT
TCAAGAACAGTTACTTCACCTTTAGAAAGGCTAAAAATCCTTAGACAATGCTCAAGTACC
GAGTATAATGGACTAAGTTTTTGGCAGTCAATGAAAAAATTCAATGATTTAGAAGGTTTC
CGTGGGTTTTTTAAAGGAAATGGTTCTAACATTATTAGAATTGTACCTTTTTCAGCCCTT
GAATTTTATGCATTTGAAAAAGCTAAGTATAGCTTGCTCCCTAGCGATAACCCTAGACAT
AAAGGGTGGCTTTTAATTTGCGGATCGATCTCAGGTATTGTGGCTAGTTTTTGCACTTAT
CCACTGGATTTAGTTCGAACAATACTAAGTATCAATGTAGATCGTGGAGGTTCTGGAATC
GCTAAAGAAACTGTCAGAATATTTAAATCAGAAGGTGTTTTTGGACTTTACAAAGGTCTA
AACATGACCTTATTTGGAATAGCTCCGTTCATAGGTATTAAAATGAGTACTTTCGATATC
CTTAAAGCTCGTTATTTACAAGACCCTAAAGATAAAAATATCGGCAAAAAAACCCTTGTT
TTAGGTGGCGTAGCTGGTGCTGTAGCCACTGCTCTTACTTATCCTACAGATTTACTTAGA
AGAAAAATGCAACTTATTACATACAATAAAAATTTGGAGACTCCTTATAAGAATATATTT
CAATGTATAAGATGGATTTACATAAACGAAGGTATTCCTGGCTTTTATAAAGGATTGGTT
CCGTGCTTCGCCAAAGTAATTCCTGCTATGGCAGTTGCTTTTGCCGTAAATGAAGAGCTT
AAAAAGTTGTTTAACGTGAGAAGTAGTTAA