Identifiers and Description

Gene Model Identifier

SteCoe_32462

Standard Name

None

Aliases

None

Description

TP6A_N domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Tetrahymena ThermophilaTTHERM_006270908.533047625744066e-17Type IIB DNA topoisomerase fam
ily protein
Required for meiot
ic DNA DSBs. Required for the
elongation of meiotic nuclei a
nd full chromosome pairing in
Tetrahymena
WormBaseWBGene000049850.0000000000002543665647376923

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_32462(Protein)
MRETLSNLKNLTHAFWAEFKTKDLSSLSFSEQIPTQEVQARIEYIVINLIQQIFSTGTIK
LSLLDQSKSSKYNPLTFINEIQEFKTNNLSAGRSLSSVAQLIKILETVYTLLESGNKATK
REVFYMAPEIFENQLKSDRAIERASALLEVPRNRLNIISAGKGLISGSLVFAENYIETPV
GNRIVKIPQDMDLITDIKTDADFVLVIEKETVLNRLVQEKFFDSCKCIGITGCGYPDLQT
REFAKRVINEFSWIPVLVLTDFDPHGVKILTTYTFGSLNRAGECDQLALPFAHWIGVHSH
EGFNKLPLSSNDYKVMNKLLSSYVFNLPPSNYQNKRFCLWRSQLEEMQKSGTKFEIEGIS
EGSLTEYILMKLQSGGWI


>SteCoe_32462(CDS)
ATGAGAGAGACTTTATCAAACCTTAAAAATCTAACTCATGCATTCTGGGCTGAGTTTAAA
ACCAAAGATTTATCATCCTTATCTTTTTCTGAACAAATACCTACTCAAGAAGTTCAAGCT
CGTATAGAATATATTGTTATAAACTTAATTCAACAAATTTTTTCAACAGGGACTATCAAA
TTATCATTACTTGATCAATCAAAAAGTTCTAAATATAACCCACTAACTTTTATAAACGAA
ATTCAGGAATTTAAAACAAATAATTTATCGGCGGGAAGAAGCTTATCTTCAGTTGCTCAA
TTGATTAAAATATTAGAAACTGTGTATACTTTGCTTGAATCAGGAAACAAAGCTACAAAA
AGAGAGGTTTTTTATATGGCTCCTGAGATATTTGAAAATCAACTAAAGTCAGATAGAGCT
ATTGAGAGAGCAAGCGCTTTGTTAGAAGTGCCAAGAAATAGGCTTAATATTATAAGTGCA
GGTAAAGGGCTTATTTCAGGAAGCCTAGTTTTTGCAGAAAATTATATAGAAACTCCTGTA
GGGAACAGAATAGTCAAAATTCCTCAAGATATGGATTTAATTACTGATATAAAGACTGAT
GCAGATTTCGTGTTGGTTATTGAAAAGGAAACAGTATTAAATAGACTAGTTCAAGAAAAA
TTCTTTGATAGTTGTAAGTGCATTGGAATAACAGGATGTGGATATCCTGATTTACAAACA
AGAGAGTTTGCTAAAAGAGTAATTAATGAATTTTCTTGGATTCCGGTATTAGTGCTTACT
GATTTTGATCCTCATGGAGTAAAAATTTTAACCACTTATACTTTTGGGAGTTTGAACAGG
GCAGGAGAATGTGATCAACTTGCTTTGCCTTTTGCCCATTGGATAGGAGTTCATAGTCAT
GAAGGCTTCAATAAACTTCCTTTAAGTAGCAACGACTACAAAGTTATGAATAAACTTCTT
TCATCTTATGTTTTTAACCTACCGCCTTCAAATTATCAGAATAAAAGATTTTGTCTTTGG
CGATCTCAATTGGAAGAAATGCAAAAATCTGGAACAAAATTTGAAATAGAAGGAATCTCA
GAAGGAAGTTTAACCGAGTATATCTTAATGAAGTTGCAAAGTGGTGGATGGATTTAG