Identifiers and Description

Gene Model Identifier

SteCoe_32693

Standard Name

None

Aliases

None

Description

hypothetical protein

Genome Browser

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Tetrahymena ThermophilaTTHERM_006898400.00000000000009357622968840175peptidyl-tRNA hydrolase

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_32693(Protein)
MYKCIIGLGNPGAFSKTRHNVGKQFLDSLGTTWKNIKEGEISMLEGITLYKPNSFMNICG
PQIKLAINRFGVTLEEIIVLHDDVELILGKAKIKKEGSAKGHNGVRSMIQTIGNSKFNRL
LIGIGRPTSGEISNYVLSPFTRAEQEILYEKVYPECSKLLGLPI


>SteCoe_32693(CDS)
ATGTATAAATGCATTATAGGTCTTGGTAACCCAGGTGCTTTTAGTAAAACAAGGCACAAT
GTCGGTAAACAATTTCTAGACTCTTTAGGTACAACATGGAAAAATATCAAAGAAGGTGAG
ATTTCTATGCTTGAAGGTATAACTTTATATAAACCCAATTCATTTATGAACATCTGTGGC
CCACAAATAAAACTCGCTATAAATCGATTTGGAGTTACCTTAGAAGAAATAATAGTCCTT
CATGATGATGTAGAACTTATATTAGGTAAAGCGAAAATCAAAAAAGAAGGTAGTGCAAAA
GGTCATAACGGGGTTAGGTCTATGATCCAAACAATAGGAAACAGTAAATTTAATAGACTC
TTAATTGGTATAGGTCGTCCAACAAGCGGCGAAATCAGTAATTACGTCTTATCCCCTTTT
ACAAGAGCTGAACAAGAAATATTATATGAAAAAGTATACCCTGAATGTTCAAAACTCTTA
GGTTTACCGATTTAA