Identifiers and Description

Gene Model Identifier

SteCoe_32735

Standard Name

None

Aliases

None

Description

Cyclin

Genome Browser

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Oxytricha TrifallaxContig19213.0.g101.5007857627073948e-41Cyclin, N-terminal domain

Tetrahymena ThermophilaTTHERM_001965903.6251409191435593e-34Cyclin, N-terminal domain cont
aining protein; Putative mitot
ic cyclin; similar to Parameci
um CYC1 and CYC2
Saccharomyces CerevisiaeYPR119W2.6102790696677047e-23B-type cyclin involved in cell
cycle progression; activates
Cdc28p to promote the transiti
on from G2 to M phase; accumul
ates during G2 and M, then tar
geted via a destruction box mo
tif for ubiquitin-mediated deg
radation by the proteasome; CL
B2 has a paralog, CLB1, that a
rose from the whole genome dup
lication
WormBaseWBGene000008651.1548224173015786e-17

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_32735(Protein)
MSIRALTHENNENCVPRIKNSHSSRHRAFGTDITNVMFTSKSENQDSKDPLYLGEYANDI
YNYLHQTETIYLPRPGYMTIQESINEKMRSILIDWLVEVHHKFKLVEETLFLTVNIVDRY
LEKTQVIRENLQLVGVSSMLIACKYEEIYAPEIKDFVYITDSAYTAEQVLETENNILRCL
CFNLTTPSTFRFLQRYARVCEIDEYAFNFARYLIELALVEYKFLKYKPSNIAASAMYLTQ
KILKNCSRSLSEQTTNTDAEIRVCAKDLALVLQRAENFTLQAVRKKFMHQKYFEVAKLQV
KI


>SteCoe_32735(CDS)
ATGAGTATCCGTGCACTTACACATGAAAATAATGAGAACTGTGTACCCAGAATTAAAAAC
TCTCACTCTTCTCGTCACCGGGCTTTCGGCACTGACATAACTAATGTCATGTTTACATCA
AAATCCGAAAACCAAGACTCAAAAGATCCATTATACCTTGGGGAATATGCAAACGATATA
TACAATTACCTTCATCAAACCGAAACAATTTACTTACCTCGTCCAGGGTACATGACAATA
CAAGAAAGCATTAACGAAAAAATGCGAAGTATCTTAATAGACTGGCTAGTAGAAGTACAT
CACAAGTTCAAACTAGTCGAAGAAACCCTTTTTCTAACCGTCAACATAGTCGACCGATAT
CTAGAAAAAACCCAAGTTATTAGAGAAAATCTTCAACTTGTTGGTGTTAGTTCAATGCTC
ATAGCTTGTAAATACGAAGAAATTTACGCACCAGAAATCAAAGACTTTGTTTATATAACT
GATAGTGCTTATACAGCAGAACAGGTTTTAGAAACAGAAAACAACATTTTACGATGTTTA
TGTTTTAATTTAACTACTCCAAGTACTTTTAGATTCTTACAAAGATATGCAAGAGTTTGT
GAAATTGATGAGTATGCCTTTAATTTCGCAAGATATCTTATTGAATTAGCTCTTGTTGAA
TATAAATTCCTTAAGTATAAACCTTCAAATATTGCTGCTTCGGCTATGTATTTAACGCAA
AAAATATTGAAGAATTGCTCGAGAAGCTTAAGTGAACAGACTACAAATACGGATGCTGAG
ATTAGGGTGTGTGCAAAGGATTTAGCATTGGTCTTACAGAGAGCGGAGAATTTTACTTTA
CAGGCTGTTAGGAAGAAATTTATGCATCAGAAATATTTTGAAGTTGCTAAATTACAGGTC
AAGATATAG