Identifiers and Description

Gene Model Identifier

SteCoe_32870

Standard Name

None

Aliases

None

Description

hypothetical protein

Genome Browser

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Oxytricha TrifallaxContig5641.0.g702.3195228302435696e-16S1 RNA binding domain

Saccharomyces CerevisiaeYMR229C0.000000000000012664165549094176RNA binding protein involved i
n synthesis of both 18S and 5.
8S rRNAs; component of both th
e ribosomal small subunit (SSU
) processosome and the 90S pre
ribosome; acts as part of a Ma
k21p-Noc2p-Rrp5p module that a
ssociates with nascent pre-rRN
A during transcription and has
a role in bigenesis of the la
rge ribosomal subunit; has bin
ding preference for single str
anded tracts of U's; relocaliz
es from nucleolus to nucleus u
pon DNA replication stress
Tetrahymena ThermophilaTTHERM_009619100.000000000005109089028063325pre-rRNA processing protein RR
P5

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_32870(Protein)
MFKLLKAEKRIRKKELSQSLAPNSYKSFEKALLSSPNSSFLWIKYAAFSLDTSGYEKSKE
ILLKALGTIVQTEEREKLNIFLALMNLESSYGNEESFEKATEWALSVNDHEKILKHKALK
LLQKGKLEDCENTLRYICKKYSKNIENWENILRFYMKDIVDNDKFDEISRRAEQALKDSV
EIRKRIGVLEYQHGSSEKARTIFENLLSEKPKRSDIWLVYLNFEEKTSGVEQVRDLYERV
MSVKFSSKVRSMFENKKEMYEHGRKHKDR


>SteCoe_32870(CDS)
ATGTTTAAGCTTCTTAAAGCTGAAAAAAGAATCAGGAAAAAAGAACTTTCACAGTCCTTA
GCTCCAAATTCTTATAAAAGCTTTGAGAAAGCACTTCTCTCATCACCTAACTCCTCCTTT
CTATGGATCAAATACGCAGCCTTTTCTTTAGACACTTCCGGCTATGAAAAATCTAAAGAA
ATCCTTCTAAAAGCATTAGGCACAATAGTCCAGACTGAAGAACGTGAAAAACTTAACATT
TTCTTAGCCCTCATGAATCTAGAGTCATCTTATGGAAATGAAGAGAGCTTCGAAAAAGCT
ACTGAATGGGCTTTATCAGTAAACGATCATGAAAAAATACTCAAACACAAAGCTTTAAAG
CTACTACAAAAAGGGAAACTTGAAGATTGTGAAAACACTTTACGATACATATGTAAAAAG
TACTCAAAAAACATTGAAAACTGGGAAAATATCTTAAGATTTTATATGAAAGATATAGTC
GATAATGATAAGTTTGATGAAATCTCAAGACGAGCAGAACAAGCTTTGAAAGATTCAGTA
GAAATACGAAAACGCATTGGAGTGCTTGAATATCAGCATGGATCAAGTGAAAAAGCTAGG
ACAATATTCGAGAATTTGCTTAGTGAAAAACCGAAAAGGTCTGATATTTGGCTTGTGTAT
CTGAATTTTGAAGAGAAAACTAGTGGAGTTGAGCAAGTTAGGGATTTATATGAAAGGGTT
ATGTCAGTGAAATTCAGCTCGAAAGTTAGAAGCATGTTTGAAAATAAAAAAGAAATGTAT
GAGCATGGAAGAAAACATAAAGATAGATAA