Identifiers and Description

Gene Model Identifier

SteCoe_32891

Standard Name

None

Aliases

None

Description

hypothetical protein

Genome Browser

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Saccharomyces CerevisiaeYDL074C0.0000022603294069810542E3 ubiquitin ligase; forms het
erodimer with Rad6p to monoubi
quinate histone H2B-K123, whic
h is required for the subseque
nt methylation of histone H3-K
4 and H3-K79; required for DSB
R, transcription, silencing, a
nd checkpoint control; interac
ts with RNA-binding protein Np
l3p, linking histone ubiquitin
ation to mRNA processing; Bre1
p-dependent histone ubiquitina
tion promotes pre-mRNA splicin
g

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_32891(Protein)
MSDGDPYKRQKTSEDSEIITSEENNLMYQNACLSSRLKDQRKQISELTIMNEQLNSKVLA
LEETLNSVNSNWAKTLSNINVLCAELTVPPEKINPFEIFIQEAPGIEPLTEMTKKCIYKL
LEAIDKVAEYESGVIVENCRAELQTNEILSENMKLKQDLKRYIDEVTRLQDTVTSLSTEK
ATLSIRLIRKGDYKIDNQSSDKTNENIDEIKNQRDTLEKMYIDESKKYSQIKYQKEVSHE
RIIRSKAFKDLIDQAKILRDKLKDYKERANYLSRYKDDHKEILRSKCEGIIEKEYKKRQS
LENEIKSLQKKMVLLEKEKNENLFELDTMRAMKNDKSTGNHFTELIDSLNKDKETLKVKN
SALQKTIEELNKKIYDYEMKGIETSQEPENIKFLKIIDDYKQKLKNEQAMQEKLYGEIGV
AEDAYEKIEEKMRNLALQLVEQEKLYNKLMNEKVRESAWKGVHNKEKLAYEEKIKSLEEL
IVSHEALHKAYEGQLKIKDNLIADMGNKCKEIETKTKHTVENFEEGILRSSEMAGYKKYY
IESLKRSQEIVSRLTEDKVRLTRKNEELRKENILLEEKSKSEKDLNNVKSADELLNAEVA
VYRKMIKCSVCCVNTKDIILSKCLHTFCKVCLNEQLASRKRKCPLCKIRFSADDMKNFWW
ENT


>SteCoe_32891(CDS)
ATGTCAGACGGAGATCCTTACAAAAGACAAAAAACATCTGAGGATTCAGAAATAATCACC
TCAGAAGAAAATAATCTTATGTACCAAAATGCTTGCTTATCCAGCAGGTTAAAGGATCAA
CGTAAGCAAATCTCTGAACTGACTATAATGAATGAACAACTGAATTCTAAAGTTTTGGCA
CTAGAAGAAACTTTAAATTCTGTCAATAGCAATTGGGCAAAAACTTTAAGTAATATAAAC
GTTTTATGTGCAGAACTTACAGTTCCGCCTGAAAAAATTAATCCATTTGAAATTTTTATT
CAGGAAGCTCCTGGCATTGAGCCCCTCACTGAAATGACAAAAAAATGCATATACAAACTT
TTAGAAGCCATCGACAAAGTAGCTGAATACGAGTCAGGAGTTATAGTCGAAAACTGCAGA
GCCGAACTGCAAACGAACGAAATTCTCAGTGAAAACATGAAACTTAAGCAAGACCTAAAA
CGTTATATCGACGAAGTTACTAGATTGCAAGACACAGTCACATCTTTAAGTACAGAAAAA
GCAACCCTATCAATCCGACTCATAAGAAAAGGTGACTATAAAATCGATAATCAATCCTCA
GACAAAACTAATGAAAATATCGATGAAATCAAAAACCAAAGAGACACACTTGAAAAAATG
TACATTGACGAATCTAAAAAATACTCACAAATCAAATACCAAAAAGAAGTCTCACATGAA
CGAATAATTCGTTCCAAAGCTTTCAAAGATCTTATCGACCAAGCTAAAATCCTAAGAGAC
AAATTAAAAGACTATAAAGAAAGGGCTAATTATTTAAGCAGATATAAAGATGATCATAAA
GAAATCCTTAGGTCTAAATGTGAAGGGATAATAGAAAAAGAGTATAAAAAAAGACAAAGC
TTAGAAAATGAAATAAAGTCTTTGCAAAAAAAAATGGTCCTATTAGAAAAAGAAAAAAAC
GAAAATTTATTTGAACTTGATACCATGCGGGCTATGAAAAACGATAAAAGCACTGGAAAC
CATTTCACCGAATTAATAGATTCACTTAATAAAGACAAAGAAACATTAAAAGTGAAAAAT
TCTGCATTACAAAAGACTATTGAAGAACTCAATAAGAAAATCTATGATTACGAAATGAAA
GGAATAGAGACTTCTCAGGAACCTGAGAATATAAAATTTTTGAAAATAATTGATGATTAT
AAGCAGAAACTAAAAAATGAACAAGCAATGCAAGAAAAATTATATGGGGAAATCGGAGTA
GCTGAAGATGCTTATGAAAAAATTGAAGAGAAAATGAGAAATCTTGCACTCCAACTTGTA
GAACAAGAGAAATTATATAATAAGCTTATGAATGAAAAAGTTAGAGAAAGTGCATGGAAA
GGTGTCCATAATAAAGAAAAACTTGCATATGAGGAAAAAATTAAAAGTCTTGAAGAATTG
ATAGTATCACATGAAGCTCTACATAAAGCCTATGAAGGGCAGTTAAAAATTAAAGATAAT
TTAATTGCAGATATGGGAAATAAATGCAAGGAAATTGAGACTAAAACAAAGCATACAGTT
GAGAATTTTGAAGAAGGTATTTTAAGATCAAGTGAAATGGCTGGGTATAAGAAATATTAT
ATTGAAAGTCTTAAAAGGTCCCAAGAAATTGTGTCAAGATTGACTGAAGACAAAGTTAGG
CTAACAAGGAAAAATGAAGAATTAAGAAAAGAAAATATTTTGTTGGAAGAGAAATCTAAA
AGTGAAAAAGACTTGAACAATGTGAAATCAGCTGATGAATTACTAAATGCAGAAGTCGCT
GTTTATAGAAAAATGATTAAGTGCTCAGTTTGCTGTGTTAATACGAAAGATATTATTTTA
AGCAAGTGCCTCCATACGTTTTGTAAAGTGTGCTTAAATGAGCAATTAGCTAGTAGAAAA
AGAAAATGCCCTCTGTGTAAAATTAGGTTCAGTGCTGATGACATGAAGAATTTTTGGTGG
GAAAATACTTAA