Identifiers and Description

Gene Model Identifier

SteCoe_32966

Standard Name

None

Aliases

None

Description

hypothetical protein

Genome Browser

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Saccharomyces CerevisiaeYGR098C2.1151310375910805e-19Separase, a caspase-like cyste
ine protease; promotes sister
chromatid separation by mediat
ing dissociation of the cohesi
n Scc1p from chromatin; inhibi
ts protein phosphatase 2A-Cdc5
5p to promote mitotic exit; in
hibited by Pds1p; relative dis
tribution to the nucleus incre
ases upon DNA replication stre
ss
Tetrahymena ThermophilaTTHERM_002971600.000000000000001713908431542013Separase protein, required for
mitotic and meiotic chromosom
e segregation
WormBaseWBGene000047750.0000000000006914400106940203

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_32966(Protein)
MSSNQENCPKFFDYSQKSSKLLSNFQTFFKPIIDCTNPSRMTARKLHQTYGGILISIVKQ
ANSDLLKKSHEKNSDYLLDLMGLSLTQLSKLSSHCLENKDDFYNLYYNFLSRMSDLGRYK
EAQKQCLELIEELEKQDFCPILVNFYILISNCILQQNNKGIKGLEQAYDFLDIKCRNAVN
NHKKAFDGQMMNKIYQNAFKLLMKTGKLLDNYAAGNASLHEQALVIRTSSLNYLRKTRPF
ISSDFFAFAYSSVLGCYKIAASIGSKALFNACLDSIDTIKGLFIKKVEIIENDAGVKQSM
SKNFSETHDLPYENDKNFRNLVELSSLMYIKTECFKKVKQVLMGLISRTDNVVCMLYDIK
YYLEITRASFLGKLELISDLEGLSKACVDFFDCKLTSPLTLVSSELTELKDLTPKVIFQF
DSLIKLLANLHTPNAIKTGISLPIETLKLLLDVLKYTPKLIRFNEKLGIQKPCDLHIYHY
TIFLNCTLVFISTREPIYINTAYSSLISLINNNTNGLINNSYNVSLNLMQTGEKDLAFKF
AVGILEHLNGINEVSIVVIEFITKYATDSLQGTKSVRKYVLEFFEKAVKVLDWEKYEKEL
MKIVEILVWVECIEIEYGGDVNSGFINWTCEKNLQCKILEKKIESYYRKLLSKPEANLAK
HLCNRIQEITKVLLWDFHISYSPQFIHAFVSYIEILSACGTFFENESIISQIFKGISNET
DVSKGDQMIFVINYLIKQSKHPLLIIWKCLLLFESMKEVDKGASDEWISGESLQKYMKIV
KLLKKVSESFAEKLGCKVEKDTNDIAAEENTEAGMLSLHELQGISLXAGMLSLHELQGIS
LVIEITDLLELYALKVRFLNILLYVAVKNGQSNACISCLKYRKLQTLLQTGKSIDNSLPS
TPKVDPSSDTDTFFSSLWANIYYSEVIFAQGEITKSSSILSNLSDLLTINHLALKRGQLA
KSYIFYLQSTISLLNGDYTLSFHLCKQARDAIKDGSINTVTCRNLTILHSLNDVCGRSFF
TVFPATSWSFQSFSYIYALHFSEIYTKLSVIPNALILLTTSIKIGKMLSIPNMFIQASSK
ACILLRQATINSFQENVQQQSLHVLSPVEFIENIYTKFFSYFLIKKDQQKYSEHCCENLD
YADIKKLCTYLEPDILCDLLMNLGDILQTPYYQNEISGPAAEQNYYKLSSFLLESAHKSY
KTRISLSMLNRKLTFLSNRQHPGKPSLELIEKAIDSVSCCPNFINKTLCKHEISPFLSEE
LCFGLMNMADILIIRNEDYTSYIEYILEKNQIQNPVILTHSHYLLARNPQLTSWKRAYHI
IMSIGPAYNRQAGFDNYKNPEDLFSDIQILPDDWTIVALSIGRGSLSEGTILTRIQKSKD
PVSFLISNKCCTGNENLDNYLYEFSEIMKLSATTTGKNNGIIRQASGQWWEKREKLDERL
KQFLEDLERNYMGILSALFIGRISDKEIDRVLYNTAKDLVPDTVCNCGQVWDFQVVYCLM
TGYICDLIPFDIFKAYISSSVYTKHTDIIIKKLKVLKKSTPNTLTQSPVILLISGHLLHL
PWESMKILSNSYTTRALSAKFLFSQLPNKNLAYSNASYILNPSKDLESTQKVFENYFLNH
ENWTGIIANPPSEDEFASMLENKELVVYCGHSGGEQYIKGEKVRGLKIKAATMLFGCSSG
LLRSQGFYEPFGIAVQYMIGGCPGLLANLWDVTDKDIDRFALEMLKKIEQGFSIGLAISA
ARSACKLKFLVGSAPVWYGLPLEFHL


>SteCoe_32966(CDS)
ATGAGTTCAAATCAAGAAAACTGTCCCAAATTCTTCGACTACTCTCAAAAATCATCAAAA
CTCCTTTCAAATTTCCAAACCTTCTTCAAACCAATTATTGACTGCACAAATCCATCAAGA
ATGACAGCAAGAAAGCTTCATCAAACCTATGGCGGTATTCTAATATCCATAGTCAAACAA
GCCAATTCTGATTTACTAAAAAAATCACATGAAAAAAATTCTGATTACCTTTTAGACCTA
ATGGGTTTATCTTTAACCCAACTTTCAAAGCTTTCCTCACATTGTCTTGAAAATAAAGAC
GATTTTTACAATCTTTACTACAATTTTTTATCCAGAATGAGTGACCTTGGCCGATATAAA
GAAGCACAAAAACAATGCTTAGAACTTATTGAGGAACTTGAAAAACAAGACTTTTGCCCA
ATTCTCGTTAATTTTTATATCCTTATCTCAAATTGTATACTACAACAAAACAATAAAGGG
ATAAAAGGATTAGAACAAGCATATGACTTTTTAGATATCAAATGCAGAAACGCTGTTAAT
AATCATAAAAAAGCTTTTGATGGACAGATGATGAATAAAATCTATCAAAATGCTTTCAAA
CTTTTAATGAAAACTGGAAAACTACTTGATAACTATGCTGCTGGTAACGCCAGTTTACAT
GAACAAGCATTAGTAATCCGTACAAGTTCTTTAAATTATTTACGTAAAACACGTCCTTTT
ATATCAAGTGATTTCTTTGCTTTTGCTTATAGTTCAGTGCTAGGATGTTATAAAATTGCT
GCTTCAATTGGTTCAAAAGCCCTTTTTAATGCATGTTTAGATTCGATTGATACAATTAAA
GGACTTTTTATTAAGAAAGTTGAGATTATTGAGAATGATGCTGGGGTTAAACAAAGTATG
AGTAAAAATTTTTCGGAAACTCATGATTTACCTTATGAAAATGATAAAAATTTTAGGAAT
CTTGTGGAATTGTCCTCGTTGATGTATATTAAAACTGAATGTTTTAAAAAAGTTAAACAG
GTGTTGATGGGTTTGATTTCTCGTACTGATAATGTTGTGTGTATGTTATATGATATTAAA
TACTATTTAGAAATTACTAGGGCTAGTTTTTTAGGGAAACTTGAACTGATTTCGGATTTA
GAAGGACTTTCTAAGGCGTGTGTGGATTTTTTTGATTGTAAACTTACGTCGCCATTGACT
TTAGTATCCTCAGAACTTACTGAACTCAAAGATCTAACCCCAAAAGTTATTTTCCAGTTC
GATTCTCTTATTAAACTCTTAGCTAACCTTCATACACCAAATGCTATAAAAACTGGTATA
TCACTTCCTATTGAAACCTTAAAACTCCTCCTTGATGTCCTCAAATACACACCAAAACTT
ATCCGATTCAATGAAAAACTTGGAATCCAAAAACCATGCGATTTACACATTTACCACTAT
ACAATCTTCCTTAATTGCACATTAGTCTTCATTTCAACTAGAGAACCAATTTATATAAAC
ACAGCATATTCAAGTCTTATATCTCTTATAAATAACAATACTAATGGACTTATTAACAAT
TCATATAATGTATCATTAAATCTAATGCAAACTGGGGAAAAAGATTTAGCTTTTAAATTT
GCTGTTGGAATACTAGAACATCTAAATGGAATAAATGAAGTTTCTATAGTAGTTATTGAG
TTTATAACAAAATATGCTACAGATAGTTTACAAGGGACAAAAAGTGTTAGGAAATATGTT
TTGGAGTTTTTTGAAAAAGCTGTTAAAGTTCTTGATTGGGAAAAATATGAGAAAGAATTG
ATGAAAATTGTTGAGATTTTAGTATGGGTTGAATGTATAGAAATCGAATATGGGGGTGAT
GTGAATAGTGGATTTATCAATTGGACTTGTGAGAAAAATCTTCAATGCAAGATTTTGGAG
AAAAAAATAGAATCATATTATAGGAAATTATTAAGTAAACCAGAAGCTAATTTAGCAAAA
CACCTCTGCAACCGTATTCAAGAAATAACAAAAGTTTTATTATGGGATTTTCATATAAGC
TATAGTCCTCAGTTTATTCATGCTTTTGTTTCTTATATTGAAATCCTTTCAGCTTGTGGG
ACATTTTTTGAAAACGAGAGTATTATAAGTCAAATTTTTAAAGGTATAAGTAATGAAACT
GATGTATCTAAAGGAGATCAGATGATTTTTGTTATAAATTATCTAATAAAACAGTCTAAA
CACCCTTTGCTTATTATTTGGAAATGCTTATTATTATTTGAGTCTATGAAAGAGGTAGAT
AAAGGTGCAAGTGATGAGTGGATAAGTGGAGAAAGTCTTCAAAAATATATGAAAATTGTC
AAGTTACTTAAAAAAGTGTCGGAAAGTTTTGCTGAGAAATTAGGGTGTAAAGTTGAAAAA
GATACAAATGATATAGCCGCAGAGGAAAATACAGAAGCTGGGATGCTAAGTTTACATGAA
TTACAAGGGATAAGTTTGNAAGCTGGGATGCTAAGTTTACATGAATTACAAGGGATAAGT
TTGGTTATAGAAATTACTGATTTGCTTGAACTTTATGCTTTAAAAGTTAGATTTTTGAAT
ATTCTCTTGTATGTGGCAGTGAAAAATGGGCAATCTAATGCTTGTATTTCATGTTTAAAA
TATCGAAAGCTCCAAACACTTTTACAAACAGGAAAATCTATCGACAACTCTCTTCCATCA
ACACCAAAAGTCGACCCATCATCAGATACTGACACATTTTTCTCATCTTTATGGGCAAAT
ATTTACTACTCCGAAGTGATTTTCGCTCAAGGAGAAATCACAAAAAGTTCTTCCATTTTA
TCAAACCTATCTGATTTATTAACAATAAACCACCTTGCTTTAAAACGTGGCCAATTAGCA
AAATCATATATTTTCTATCTCCAATCCACAATATCTTTATTAAACGGTGATTATACATTA
AGTTTCCATTTATGTAAACAAGCAAGAGATGCAATAAAAGATGGTTCTATTAACACAGTC
ACATGTAGAAACCTAACAATTTTACATTCATTAAACGATGTTTGTGGTCGTAGTTTCTTT
ACAGTTTTTCCAGCAACATCCTGGTCATTCCAAAGTTTTTCTTATATTTATGCTTTACAC
TTTTCTGAAATCTACACAAAATTATCAGTTATCCCAAATGCTTTAATATTACTAACAACT
AGTATAAAAATAGGTAAAATGCTTTCAATACCTAATATGTTTATACAAGCATCATCAAAA
GCATGTATTTTATTAAGACAAGCTACAATTAATTCATTTCAAGAAAATGTTCAACAACAA
TCTTTACATGTTTTATCCCCAGTTGAGTTTATTGAAAACATATACACGAAATTTTTCTCA
TATTTTCTTATTAAAAAAGATCAACAGAAATATTCAGAACATTGTTGTGAAAACCTTGAT
TATGCTGATATAAAAAAACTATGTACTTATTTAGAACCTGATATCCTTTGTGATCTTCTT
ATGAATCTTGGGGATATACTACAAACTCCTTATTACCAAAATGAAATCTCAGGTCCTGCC
GCTGAACAGAACTACTATAAACTGTCAAGTTTTTTATTAGAATCAGCACATAAAAGTTAT
AAAACCAGGATATCTCTTTCAATGCTTAATCGCAAACTAACTTTTCTCTCAAACAGGCAA
CACCCTGGCAAGCCAAGTTTAGAACTTATAGAAAAAGCAATTGACAGTGTATCTTGTTGT
CCGAATTTTATCAACAAAACCCTCTGCAAGCATGAAATATCCCCATTTTTATCAGAAGAA
CTCTGTTTTGGCCTTATGAATATGGCTGATATTTTAATTATAAGAAATGAAGATTATACT
TCATATATCGAATATATATTAGAAAAAAATCAAATCCAAAACCCTGTTATATTAACTCAT
TCCCATTACCTTTTAGCTAGAAATCCTCAACTTACTTCATGGAAAAGGGCTTATCATATT
ATCATGTCTATAGGCCCAGCTTATAATCGTCAAGCAGGTTTTGATAATTATAAAAACCCT
GAAGACCTATTTTCAGACATACAAATTTTACCTGATGATTGGACTATTGTCGCTTTATCT
ATTGGTCGTGGAAGTTTAAGTGAAGGGACAATACTTACTCGTATACAGAAATCAAAAGAC
CCAGTGAGTTTTCTTATAAGCAACAAATGTTGTACTGGGAATGAAAACCTTGATAATTAT
TTGTATGAGTTTTCTGAAATTATGAAATTATCAGCGACAACCACAGGGAAAAATAATGGG
ATTATAAGACAAGCTAGTGGGCAATGGTGGGAAAAAAGAGAAAAACTTGATGAAAGGTTG
AAACAGTTTCTAGAAGATTTAGAAAGGAATTATATGGGGATATTATCAGCATTGTTTATA
GGGAGGATTAGTGATAAAGAAATTGATAGAGTTTTATATAATACTGCTAAAGACCTTGTA
CCTGATACAGTGTGTAATTGTGGACAGGTTTGGGATTTTCAAGTTGTATATTGTTTAATG
ACAGGATATATATGTGATTTGATTCCTTTTGATATATTTAAAGCTTATATATCATCAAGT
GTATATACAAAACATACTGATATTATAATAAAAAAACTTAAGGTATTAAAAAAATCTACA
CCTAACACCCTAACACAATCTCCAGTTATCCTTTTAATAAGTGGACATCTCTTACACCTA
CCTTGGGAATCTATGAAAATACTCAGTAATTCCTACACAACCCGAGCACTTTCTGCAAAA
TTCCTCTTTTCACAATTGCCTAATAAAAACCTAGCTTATTCAAATGCGTCGTATATTTTA
AATCCAAGTAAAGACTTGGAATCAACACAAAAAGTTTTTGAGAATTATTTTTTAAACCAT
GAAAACTGGACTGGAATCATTGCAAACCCTCCAAGTGAAGATGAATTTGCTAGTATGCTT
GAGAATAAAGAACTTGTAGTATATTGTGGACATTCAGGAGGTGAACAGTATATTAAAGGG
GAAAAAGTTAGAGGATTGAAAATAAAAGCTGCGACTATGCTTTTTGGATGCTCTAGTGGG
TTACTTAGGAGTCAAGGGTTTTATGAACCTTTTGGAATTGCTGTACAGTATATGATTGGA
GGATGTCCTGGATTATTAGCTAATTTGTGGGATGTTACGGATAAAGATATTGATAGGTTT
GCTTTAGAAATGCTTAAGAAGATTGAGCAAGGGTTTTCAATTGGATTAGCTATTTCAGCT
GCTAGGAGCGCTTGTAAGCTTAAGTTTTTGGTAGGTTCTGCACCTGTGTGGTATGGACTA
CCTTTAGAGTTTCATTTGTAA