Identifiers and Description

Gene Model Identifier

SteCoe_33028

Standard Name

None

Aliases

None

Description

AMPK subfamily kinase

Genome Browser

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Tetrahymena ThermophilaTTHERM_006708601.0927656633766312e-73Protein kinase domain containi
ng protein. Sequence similarit
y to the AMPK subfamily of the
protein kinase CAMKL family (
Eisen et al., 2006)."
Oxytricha TrifallaxContig21811.0.g291.6218080426054863e-71Protein kinase domain

WormBaseWBGene000201424.0795586671775603e-41
Saccharomyces CerevisiaeYDR477W2.2273635617957438e-39AMP-activated serine/threonine
protein kinase; found in a co
mplex containing Snf4p and mem
bers of the Sip1p/Sip2p/Gal83p
family; required for transcri
ption of glucose-repressed gen
es, thermotolerance, sporulati
on, and peroxisome biogenesis;
involved in regulation of the
nucleocytoplasmic shuttling o
f Hxk2p; regulates filamentous
growth in response to starvat
ion; SUMOylation by Mms21p inh
ibits its function and targets
Snf1p for destruction via the
Slx5-Slx8 Ubiquitin ligase

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_33028(Protein)
MSGESNQQVPAPKERDIGDYTISKTIGEGTFGKVKLGFHKMTGEKVAIKILEKNRIIDVA
DIERVSREIHILKLIRHPNIIQLYEIIETPSRLYLIMEYASSGELFDYIVAQTRIKEQEA
CKIFQQVIAGIEYIHKLNVVHRDLKPENLLLDHNHDIKIVDFGLSNTYNKNELLKTACGS
PCYAAPEMIAGKEYSGCKVDIWSSGVILFAMICGYLPFEDPKTSKLYKKILKGVYTAPNY
ISESAKDLIKNILRTDPDQRYTIDEIKNHEWFNQVKQEISSGILVGYQNIQVDNIILNKL
ENYKVDLDYAKKCIEANKHNSVSTGYYLLLKKHLRNGGTSVASYSKTNDLETTRIKSHTR
VYSLNVSQDTIPLYRLSHDKIFTPGPKKLFEYIKSPKHSSSPRNSQKGYHGRNLSQVVER
NPSPRQIFYANEGKKSKGTNKHLSTPRPPSREQFKFMRIRRDGDRVNESLDARKDTFLNG
RPTVNLRSLTAAEEKNTLKPIKIRRELYLK


>SteCoe_33028(CDS)
ATGTCAGGCGAAAGTAATCAGCAAGTGCCAGCACCAAAAGAGAGAGATATAGGTGACTAC
ACCATAAGTAAAACAATTGGTGAAGGAACTTTTGGCAAAGTCAAGCTTGGTTTCCATAAG
ATGACTGGTGAAAAAGTAGCTATTAAAATTCTTGAGAAAAATAGGATTATTGATGTAGCT
GATATCGAAAGAGTATCCAGAGAAATCCACATCTTAAAACTAATAAGACATCCTAATATT
ATCCAACTCTATGAAATTATAGAAACGCCTTCAAGACTGTATTTAATCATGGAATACGCG
AGCTCTGGAGAACTATTTGACTATATTGTAGCTCAAACTCGCATAAAAGAACAAGAAGCT
TGTAAAATATTCCAGCAAGTAATAGCAGGCATTGAATACATTCACAAATTAAATGTTGTG
CATCGTGATCTCAAGCCTGAAAATCTCCTCCTGGATCATAATCATGATATCAAAATAGTT
GATTTCGGCCTTTCAAATACCTATAACAAAAATGAACTACTTAAAACAGCTTGTGGTTCA
CCATGCTATGCAGCTCCTGAAATGATCGCAGGCAAAGAATACTCTGGTTGCAAAGTCGAC
ATATGGAGTTCAGGGGTAATTCTTTTTGCGATGATTTGTGGATATCTGCCTTTCGAAGAT
CCTAAAACAAGTAAATTGTATAAAAAAATCCTTAAAGGCGTTTATACAGCTCCTAATTAC
ATTTCGGAAAGTGCTAAAGATTTGATTAAAAACATTTTAAGGACTGACCCAGACCAGCGT
TATACAATAGATGAAATTAAAAATCATGAGTGGTTTAATCAAGTCAAACAAGAAATAAGC
AGTGGGATACTTGTTGGATATCAAAATATCCAAGTGGACAATATAATTTTAAACAAGCTT
GAAAATTATAAAGTCGATCTTGACTATGCTAAAAAGTGTATTGAAGCAAACAAACATAAT
AGTGTGTCTACTGGATATTATCTTTTACTGAAAAAGCACTTAAGGAATGGTGGAACTTCA
GTTGCTAGTTATTCAAAAACCAACGATCTAGAAACCACAAGAATCAAATCTCATACTAGG
GTTTATAGTTTAAATGTGTCTCAAGATACAATTCCTTTGTACAGATTAAGTCATGATAAA
ATCTTCACCCCTGGACCTAAAAAACTTTTCGAATATATTAAATCTCCTAAGCATTCTTCA
AGTCCAAGAAACTCACAAAAAGGATATCATGGAAGGAATTTGTCACAGGTTGTTGAAAGA
AATCCTTCGCCTCGACAAATTTTCTATGCTAATGAAGGGAAGAAATCAAAAGGGACTAAT
AAACACTTGTCGACTCCTAGGCCGCCAAGTAGGGAGCAATTTAAGTTTATGAGAATAAGA
AGAGATGGAGATAGAGTAAATGAAAGTTTGGATGCAAGAAAGGACACTTTTCTTAATGGT
AGACCGACAGTAAACCTTAGAAGCCTTACTGCTGCTGAAGAAAAAAATACTTTGAAGCCT
ATCAAGATTCGCAGAGAGCTTTATTTGAAATAG