Identifiers and Description

Gene Model Identifier

SteCoe_33380

Standard Name

None

Aliases

None

Description

hypothetical protein

Genome Browser

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Oxytricha TrifallaxContig8575.0.g1101.5400882849875202e-51DEAD/DEAH box helicase

Tetrahymena ThermophilaTTHERM_007008701.6889118802245324e-48DExD/H box RNA helicase
Saccharomyces CerevisiaeYGL171W1.1089390193121365e-40RNA-dependent ATPase; involved
in pre-rRNA processing at sit
es A0, A1, and A2, and in cont
rol of cell cycle progression;
contains two upstream open re
ading frames (uORFs) in 5' unt
ranslated region which regulat
e translation
WormBaseWBGene000110323.0144087850653746e-40

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_33380(Protein)
MDSFAMLKDGVSFDRKRFANDISLFSESLPQKKPKIEAPSTNNIRKEFKIHTSGSNIPEP
ISSWSQLFQLYPFLQKTQDLITKQYENLTAVQMQAFPLLMQKRDTIAIAPTGSGKTLAYL
LPLISLVKNREKLKGLIITPTKELARQVFKEFVVLSEGTGIVGQLIRKRGKELEELTEDC
DVIICTPLTLVHMMGENDLPSIEFVIIDESDQLFDMGYLDQVDQILKKCQGGCTKWMFSA
TMLPAVEMLAYSMLIDPAKISVGIQNATVSTVSQELKFCTNEAGKTIALKQMMQNGELSP
PVLVFVQSKDRAIQLGKEIKELVPHTLAIHSGLDDKNREIIVKNFRTGSTWILICTDLMS
RGMDFHGVRLIINFDFPQSVISYIHRIGRAGRAGETAKAVTFYTIEDAPYVKMIANVMKK
SGFEVPEWMMKLKTPSKEMKKKLEKKPIKRENISSKYRISRSLRKFMKKKHQQSSEDQAE
EKI


>SteCoe_33380(CDS)
ATGGACTCCTTTGCTATGCTAAAAGACGGAGTGTCCTTCGATCGAAAACGTTTCGCAAAC
GATATCTCTCTTTTTTCTGAATCTCTACCACAAAAGAAACCTAAAATCGAAGCACCATCC
ACAAATAACATTCGTAAGGAGTTCAAAATTCACACATCTGGAAGCAACATCCCAGAGCCA
ATCTCATCATGGAGCCAACTTTTTCAATTATATCCTTTCCTTCAAAAAACACAAGATCTC
ATAACAAAACAGTATGAAAATTTGACAGCTGTTCAAATGCAAGCCTTTCCTTTACTAATG
CAAAAAAGAGACACAATTGCCATAGCCCCAACAGGTTCTGGGAAAACTTTAGCTTATCTT
TTACCACTTATTTCACTAGTAAAAAATAGAGAAAAGCTTAAAGGGTTAATTATTACCCCA
ACTAAAGAACTTGCTAGACAGGTATTCAAAGAATTTGTAGTGCTTAGTGAAGGCACTGGG
ATTGTTGGACAATTGATTAGGAAGAGAGGAAAAGAACTTGAAGAATTAACTGAAGATTGT
GATGTGATTATTTGTACACCTTTGACTTTGGTGCATATGATGGGAGAGAATGATTTACCT
AGTATAGAGTTTGTGATTATTGACGAATCTGATCAATTGTTTGATATGGGATATTTAGAT
CAAGTTGACCAGATATTGAAAAAATGTCAAGGAGGATGCACAAAATGGATGTTTTCAGCA
ACAATGCTCCCAGCTGTCGAAATGTTAGCATACTCCATGCTTATCGACCCTGCCAAGATC
AGTGTTGGTATTCAAAACGCAACAGTTTCCACAGTTAGCCAGGAACTAAAATTTTGCACA
AATGAAGCAGGGAAAACAATTGCCCTTAAACAAATGATGCAAAATGGTGAACTCTCACCT
CCTGTTCTTGTTTTTGTACAGTCCAAAGATAGGGCAATACAACTTGGAAAAGAAATAAAA
GAGCTTGTCCCTCATACTCTTGCTATTCACTCAGGTCTTGATGATAAAAACAGAGAAATA
ATTGTTAAAAACTTTAGAACCGGGAGTACTTGGATTTTAATATGCACTGACCTCATGTCA
AGAGGTATGGATTTTCATGGAGTCCGCTTAATAATTAATTTCGACTTTCCTCAAAGTGTG
ATTAGTTATATACACAGGATAGGAAGAGCAGGTAGAGCAGGGGAAACAGCTAAAGCAGTG
ACATTTTATACAATTGAAGATGCACCTTATGTTAAAATGATTGCTAATGTTATGAAAAAA
TCAGGCTTTGAAGTTCCTGAGTGGATGATGAAGTTGAAAACTCCAAGCAAAGAAATGAAG
AAGAAACTTGAGAAAAAGCCTATTAAACGCGAAAATATATCAAGCAAATATAGAATCAGT
AGAAGTCTTAGAAAGTTTATGAAAAAAAAGCACCAACAGAGTTCTGAAGATCAAGCTGAA
GAAAAAATATAA