Identifiers and Description

Gene Model Identifier

SteCoe_33644

Standard Name

None

Aliases

None

Description

hypothetical protein

Genome Browser

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Oxytricha TrifallaxContig10910.0.g970Calcineurin-like phosphoestera
se

WormBaseWBGene000017481.185064864233981e-27
Saccharomyces CerevisiaeYER133W6.47023492564546e-26Type 1 serine/threonine protei
n phosphatase catalytic subuni
t; cleavage and polyadenylatio
n factor (CPF) component; invo
lved in various processes incl
uding glycogen metabolism, spo
rulation, mitosis; accumulates
at mating projections by inte
raction with Afr1p; interacts
with many regulatory subunits;
involved in regulation of the
nucleocytoplasmic shuttling o
f Hxk2p; import into nucleus i
s inhibited during spindle ass
embly checkpoint arrest

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_33644(Protein)
MKGLRAEKIVQRIETSGQAPQARFGHTVTAISKTKVILFGGAIGDTGKYSITGDTFCFDI
AGRTWSRIDRVTGLAPSARAAHASCAVEGLQLVIYGGATGGGSLASDDLYLLDLRKGDDE
GSWMIVPVVGSTPGRRYGHSLIFIKPHLLAFGGNTGNESVNDVWSLNVEKSPFSWNKLEI
QGDSPKPRVYHSACLCTTGSAMGMMVIFGGRTNDQSALNDTWGLRRHRDGRWDWVRAPYK
NTAEQAFSRYQHTSLFIGSKMLVLGGRTNQVGEVVPVEAYDTESSEWVKFPSIQRFRHSS
WTLDSEVYIHGGFENETPNIPTDSIVKLDSSKLLGRTEPAPRSIPEPKINLDQNRTIPRV
SRAANKTPEIRLASNVIVLMGGEQNDDYSETVKKVPIDRLQEEGKRLGVKPLPPSVSKPQ
TAIESPSGIIVDMLLKTHDWNNLPEVKFVKTATDLNRMQIKKDSIISLIQECEELMKQEP
NVIRMRAPVKIFGSLNGQYIDLLRIFENYGEPSEHLGDGDIESFDYLFLGDYIDRGSRSL
ETICLLMALKVKYPDQIIMLRGHHEDQQINIHYGLAQECRARLDEDPADSSSVFASLNRM
FEYMPLCAIIEDKIICLHGGISQNLRTIEDLEVLQKPIIINHLPQTPEQQAIMDILWADP
CENERELGFKPHSARSIFGNIFKFGVDRVQKFLSDNKLGCLVRSHECVMEGFERNIPAEM
ITLFSATDYCGKYKNAGAILLVKRNLEIVPKIIYPLNGSAASWIENEDSLRLRPATPPRW
KPR


>SteCoe_33644(CDS)
ATGAAAGGTTTAAGAGCTGAAAAGATTGTTCAACGGATTGAGACCAGTGGTCAAGCCCCA
CAAGCTCGCTTTGGGCATACTGTAACTGCAATTTCTAAGACGAAGGTTATATTGTTTGGG
GGAGCGATTGGGGATACTGGGAAATATTCGATTACAGGTGACACTTTTTGCTTTGATATT
GCTGGGAGGACATGGTCGCGTATTGATAGAGTTACAGGCTTAGCTCCTTCAGCAAGAGCG
GCACATGCATCGTGTGCTGTAGAAGGTCTTCAATTAGTTATATATGGCGGTGCAACAGGT
GGTGGATCTTTAGCATCAGACGATCTTTACTTACTTGATTTACGTAAAGGAGACGATGAA
GGAAGTTGGATGATTGTTCCTGTAGTAGGGTCAACTCCAGGACGAAGGTATGGGCATTCA
CTGATTTTCATAAAACCACATCTTCTAGCATTCGGAGGAAATACAGGAAATGAATCAGTA
AACGATGTATGGAGCCTAAATGTAGAAAAGTCTCCATTTAGTTGGAATAAACTTGAAATT
CAAGGAGATTCTCCAAAACCAAGAGTTTATCATTCAGCATGTTTATGTACAACAGGTTCA
GCAATGGGTATGATGGTAATATTTGGTGGTCGTACAAATGATCAATCTGCACTTAATGAT
ACTTGGGGATTAAGAAGACATAGAGATGGAAGATGGGATTGGGTAAGAGCTCCATACAAA
AATACTGCTGAACAAGCTTTTTCTAGATATCAGCATACAAGTTTGTTTATTGGCAGTAAA
ATGTTAGTTTTAGGTGGTAGGACTAATCAAGTTGGAGAAGTTGTCCCAGTTGAAGCTTAT
GATACAGAAAGTAGTGAATGGGTTAAATTCCCATCAATACAAAGATTCAGACATTCTTCA
TGGACTTTAGACTCTGAAGTGTACATTCATGGGGGCTTTGAAAATGAAACTCCAAATATC
CCAACTGATAGCATAGTAAAATTAGATTCAAGTAAACTTTTAGGTAGAACCGAACCAGCA
CCCAGAAGCATCCCTGAGCCTAAAATCAACCTCGACCAAAACCGGACAATTCCTCGAGTT
TCTCGTGCTGCTAATAAAACCCCAGAAATCCGCCTTGCATCTAACGTCATTGTCCTTATG
GGTGGAGAACAAAATGATGACTATAGTGAAACAGTAAAAAAAGTCCCTATTGATCGACTT
CAAGAAGAAGGTAAAAGACTTGGTGTAAAACCTTTACCTCCAAGTGTATCTAAACCACAA
ACAGCTATAGAAAGCCCAAGTGGTATAATTGTAGACATGCTTCTTAAAACCCATGATTGG
AACAACCTCCCTGAAGTAAAATTCGTCAAAACCGCAACCGATCTAAACCGAATGCAAATC
AAAAAAGATTCAATTATATCTTTAATACAAGAATGTGAAGAACTTATGAAACAAGAACCT
AATGTTATACGCATGAGAGCTCCTGTAAAGATTTTCGGTAGTTTAAATGGGCAATATATC
GACCTTTTAAGGATTTTTGAGAATTATGGTGAACCTTCTGAACATTTGGGTGATGGGGAT
ATAGAAAGTTTTGATTATTTATTTCTTGGAGATTATATAGATAGAGGGTCGAGATCTTTA
GAAACTATATGTTTACTAATGGCTTTAAAGGTAAAATATCCTGATCAGATCATAATGCTA
AGAGGGCATCATGAGGATCAGCAAATTAATATACATTATGGACTTGCTCAAGAATGTCGG
GCAAGGCTTGATGAAGATCCAGCTGATTCATCATCAGTTTTTGCAAGTTTGAATCGTATG
TTTGAATATATGCCACTATGTGCTATTATTGAAGACAAAATCATCTGTTTACATGGAGGT
ATTTCTCAAAACCTTCGAACAATAGAAGATCTTGAAGTACTACAAAAACCTATAATTATA
AACCATTTACCACAAACCCCTGAACAACAAGCTATAATGGACATCCTTTGGGCTGATCCA
TGTGAAAACGAACGTGAACTTGGTTTTAAACCGCATTCAGCAAGGAGTATTTTTGGAAAC
ATCTTCAAATTTGGTGTGGATCGAGTGCAAAAATTCCTCAGCGATAATAAACTTGGATGC
TTAGTCAGATCTCATGAATGTGTTATGGAAGGATTTGAAAGAAACATCCCAGCTGAGATG
ATAACTTTGTTTTCAGCAACAGATTATTGTGGGAAATACAAAAATGCAGGGGCGATATTG
TTGGTGAAAAGGAATTTGGAAATTGTACCAAAGATAATTTACCCATTAAATGGGTCTGCG
GCTAGTTGGATTGAAAATGAAGATAGTTTAAGGCTTAGACCTGCCACCCCGCCTAGGTGG
AAACCTAGATAG