Identifiers and Description

Gene Model Identifier

SteCoe_33685

Standard Name

None

Aliases

None

Description

hypothetical protein

Genome Browser

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Oxytricha TrifallaxContig12890.0.g1037.281290178321643e-33Ribosomal protein S12

Tetrahymena ThermophilaTTHERM_004340405.380186160021138e-32Homolog of yeast RPS23, human
RPS23 and bacterial RPS12; sma
ll (40S) ribosomal subunit pro
tein with sequence similarity
to E.coli ribosomal protein S1
2
Saccharomyces CerevisiaeYPR132W1.462486227251231e-31Ribosomal protein 28 (rp28) of
the small (40S) ribosomal sub
unit; required for translation
al accuracy; homologous to mam
malian ribosomal protein S23 a
nd bacterial S12; RPS23B has a
paralog, RPS23A, that arose f
rom the whole genome duplicati
on; deletion of both RPS23A an
d RPS23B is lethal
WormBaseWBGene000044921.462486227251231e-31

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_33685(Protein)
MAAGKPRGIRAGRKLKKRRREQRWADKGYKKAHLSSKFKKPFAGTSHAKGIVVEKLGIES
KQPNSAVRKCVRVLLKKNGKKIAAFVPNDGCLNFIDENDEVLVAGFGRSGHAVGDIPGVR
FKVVKVKGVSLKALYLHKKEKPR


>SteCoe_33685(CDS)
ATGGCAGCAGGTAAGCCTCGAGGTATCAGGGCCGGTCGCAAACTAAAGAAACGACGACGT
GAACAAAGATGGGCTGATAAAGGCTACAAAAAAGCCCATCTCAGTTCCAAGTTCAAAAAA
CCATTCGCTGGAACATCCCATGCAAAAGGAATCGTTGTTGAAAAGTTAGGTATCGAATCT
AAACAGCCAAACTCTGCTGTGAGAAAGTGTGTGAGAGTTCTCCTTAAGAAAAACGGGAAA
AAAATCGCTGCTTTCGTGCCGAACGATGGCTGTTTGAACTTCATTGACGAAAATGATGAA
GTACTTGTTGCAGGATTTGGACGTAGTGGTCATGCTGTGGGTGATATTCCGGGTGTCAGA
TTTAAAGTTGTTAAGGTCAAAGGAGTTTCCTTAAAGGCCCTTTATTTGCACAAGAAGGAG
AAACCTAGATAA