Identifiers and Description

Gene Model Identifier

SteCoe_33694

Standard Name

None

Aliases

None

Description

hypothetical protein

Genome Browser

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
WormBaseWBGene000137661.4043787324419038e-54
Saccharomyces CerevisiaeYBR034C5.665668176358939e-52Nuclear SAM-dependent mono- an
d asymmetric methyltransferase
; modifies hnRNPs, including N
pl3p and Hrp1p, affecting thei
r activity and nuclear export;
methylates U1 snRNP protein S
np1p and ribosomal protein Rps
2p; interacts genetically with
genes encoding components of
Rpd3(L) and this interaction i
s important for Rpd3 recruitme
nt to the subtelomeric region.
Oxytricha TrifallaxContig651.1.g151.5400882849875202e-51PRMT5 arginine-N-methyltransfe
rase

Tetrahymena ThermophilaTTHERM_002194901.1379798735078682e-50hypothetical protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_33694(Protein)
MARRGRYQVNSLQKSVQNGSSEDIFQADSLWAGLDNEISTEDPYFYSYSHYGIHEEMIKD
KVRTESYMNAMIQNPHIFNDKIVLDIGCGTGILSIFASRAGAKHVYGIDAADVANQARQI
VEDNGLGHKITIIKGKVEEVELPVEKVDIIISEWMGYFLLYESMLDTVLYARDKWLQPDG
LMFPDRAKMYISGIEDADYKERKLDFWLDVYGIDMSIIRPTVMAEPIVDVVEANAIVTSE
YLLYDIDIKNVKIDDLTFASKYHLRATRSDYLHAIIAYFEVEFNHGTKQIKLSTNPAKKY
THWKQTVFYFEGAIPMNLGEEISGSIAIRKNPEHKRDVDIKISYHFNGAKTTFNETRFYK
LR


>SteCoe_33694(CDS)
ATGGCTAGAAGGGGTCGGTACCAAGTAAATTCTTTACAGAAATCAGTTCAAAATGGATCT
TCTGAAGATATATTTCAAGCCGATTCTTTGTGGGCTGGACTAGATAATGAAATTAGTACC
GAAGATCCTTACTTTTACTCATACTCACACTACGGTATTCATGAAGAAATGATTAAAGAT
AAAGTAAGGACCGAAAGCTATATGAATGCAATGATACAAAATCCCCACATATTCAATGAC
AAAATAGTCTTAGATATCGGCTGCGGAACTGGAATCTTATCAATATTCGCAAGTAGAGCG
GGGGCAAAGCACGTATATGGAATTGATGCAGCTGATGTTGCAAATCAAGCAAGACAAATA
GTTGAAGATAATGGACTAGGGCATAAAATCACTATAATAAAAGGTAAAGTTGAAGAAGTT
GAGCTTCCAGTTGAGAAAGTAGATATTATCATATCAGAGTGGATGGGATATTTTTTACTA
TATGAAAGCATGCTGGATACTGTGCTTTATGCTAGAGATAAATGGCTTCAACCTGATGGA
CTTATGTTTCCAGATAGAGCCAAGATGTATATTTCAGGTATAGAAGATGCTGATTATAAA
GAAAGAAAATTGGATTTCTGGCTCGATGTTTATGGAATTGATATGAGCATAATTAGACCA
ACTGTTATGGCTGAGCCTATAGTAGATGTAGTTGAAGCTAATGCGATTGTAACATCAGAG
TATCTTCTTTATGATATTGATATAAAAAATGTGAAAATTGATGACTTAACCTTTGCATCA
AAATATCATCTTAGGGCAACAAGATCAGATTATCTTCATGCTATAATAGCTTACTTTGAA
GTTGAGTTTAACCATGGAACAAAACAAATCAAACTTTCTACTAATCCTGCAAAGAAATAT
ACTCATTGGAAGCAGACAGTTTTTTATTTTGAAGGCGCTATACCTATGAATCTAGGTGAG
GAAATTTCAGGATCAATTGCTATAAGGAAAAATCCCGAACACAAAAGAGATGTGGATATC
AAAATATCTTATCATTTTAATGGAGCGAAAACTACTTTCAATGAGACGAGATTTTATAAA
CTAAGATAA