Identifiers and Description

Gene Model Identifier

SteCoe_33846

Standard Name

None

Aliases

None

Description

hypothetical protein

Genome Browser

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Tetrahymena ThermophilaTTHERM_005638904.0795586671775603e-41Sodium/hydrogen exchanger fami
ly protein
Oxytricha TrifallaxContig16604.0.g631.8048513878454153e-35Sodium/hydrogen exchanger fami
ly

Saccharomyces CerevisiaeYDR456W1.4251640827409352e-21Na+/H+ and K+/H+ exchanger; re
quired for intracellular seque
stration of Na+ and K+; locate
d in the vacuole and late endo
some compartments; required fo
r osmotolerance to acute hyper
tonic shock and for vacuolar f
usion; ortholog of human NHE9,
which is linked to autism
WormBaseWBGene000037331.5628821893349888e-18

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_33846(Protein)
MTGYLGVEVLLAVVTLILYIFFAQFLENSKCEVLHETSIAIIVGAAGGLAIFTIGGAEKI
EFSTGIFFYFILPPIIFTAGYTLKSQHFFLNIGFILLYGVVGTFLSFITLGSLAYFFVEQ
GAASTTLSLKDCLLLASVLSATDTVAAITVIKETKYPRLHYILFGEGVLNDAVSIVLFRT
VNSVSDEEGLNWLELIWGFLLTTVLSILIGLAVGLLASWIIKRFPNLSLHPERESAIIIL
FGYLSYTVSEILGLSGIMAIFFCGVILAHYAWHNLSRKSQEGTDLVFKVISQGAEAFTVT
YLGMSVTTIAWEDWNLMFLACMFVAMILGRTASIFISSGIVYLLQCGQFGLDFKSISVAW
FGGLIRGSVAFAMVLQIESSNYNTLVSTALGIALISTVGLSNMMTLFTRFVGLEQNSSEE
IYFELMSVSAKDDPFYSKNLKKSGLGGFHRLWQKIDEGYLGPIFGAEEKNKSKNVWDKVW
AEEDTEMSNQGSLK


>SteCoe_33846(CDS)
ATGACAGGTTATTTAGGAGTTGAAGTGCTTTTAGCTGTGGTCACACTGATATTATATATA
TTTTTTGCCCAGTTCTTAGAGAATAGTAAGTGCGAAGTTCTCCATGAAACGAGTATTGCT
ATTATTGTTGGAGCTGCTGGAGGGTTGGCGATTTTTACTATAGGTGGTGCTGAAAAAATA
GAATTCTCAACAGGGATATTCTTTTATTTCATTTTGCCACCAATTATATTCACAGCAGGC
TACACACTAAAATCTCAACACTTCTTCCTAAACATAGGGTTCATTTTACTATACGGAGTG
GTCGGGACATTTTTATCCTTCATAACTCTAGGTTCACTAGCTTATTTCTTTGTAGAACAA
GGTGCTGCATCTACAACTTTATCCTTAAAAGACTGTTTATTATTAGCAAGTGTCCTCTCA
GCAACAGATACAGTAGCAGCAATAACAGTTATAAAAGAAACTAAGTACCCAAGACTTCAT
TATATATTGTTTGGTGAAGGTGTTTTAAATGATGCAGTATCAATAGTCCTTTTCAGAACT
GTAAATTCTGTGTCTGATGAAGAAGGGCTGAATTGGCTTGAGCTTATATGGGGATTTTTA
TTGACTACAGTCCTGAGTATTTTGATTGGGTTGGCTGTTGGACTTTTGGCTTCATGGATT
ATCAAACGATTTCCTAATCTGTCCCTTCATCCTGAAAGAGAAAGTGCAATAATTATACTT
TTTGGATATTTGTCTTATACTGTATCAGAAATTCTAGGCTTATCAGGAATAATGGCTATT
TTCTTTTGTGGAGTTATACTTGCACATTATGCATGGCATAATCTATCTAGAAAATCACAA
GAAGGTACTGATTTGGTTTTTAAGGTTATTTCACAAGGTGCAGAAGCTTTTACTGTTACT
TACTTGGGAATGTCAGTAACAACTATAGCTTGGGAAGACTGGAATTTAATGTTCCTTGCT
TGTATGTTTGTTGCTATGATACTTGGAAGAACTGCATCAATATTTATAAGTTCTGGAATT
GTTTATTTATTACAGTGTGGGCAATTTGGCTTAGATTTCAAAAGTATCAGTGTAGCTTGG
TTTGGAGGATTGATAAGAGGTTCAGTTGCTTTTGCTATGGTACTTCAAATTGAGAGTAGT
AATTATAATACATTAGTTTCAACAGCCTTGGGTATTGCTCTAATATCAACAGTTGGACTA
AGCAATATGATGACTCTCTTTACGAGGTTTGTCGGTCTTGAGCAAAATTCATCTGAAGAA
ATTTACTTTGAACTAATGTCAGTCTCTGCAAAAGATGACCCTTTCTACTCTAAAAATTTG
AAAAAATCTGGCCTTGGAGGATTTCATAGATTATGGCAAAAGATTGATGAAGGGTATCTT
GGTCCTATTTTTGGAGCTGAGGAAAAAAACAAGAGTAAGAATGTTTGGGACAAGGTATGG
GCTGAAGAAGATACTGAAATGAGCAATCAAGGCAGTTTGAAATAA