Identifiers and Description

Gene Model Identifier

SteCoe_33914

Standard Name

None

Aliases

None

Description

hypothetical protein

Genome Browser

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Oxytricha TrifallaxContig5265.0.g85.242885663363464e-22Ras family

WormBaseWBGene000110834.248354255291589e-18
Tetrahymena ThermophilaTTHERM_008528506.305116760146989e-16Homolog of D. melanogaster Rab
32; small monomeric GTPase tha
t regulates membrane fusion an
d fission events
Saccharomyces CerevisiaeYOR089C0.0000000000002543665647376923Endosomal Rab family GTPase; r
equired for endocytic transpor
t and sorting of vacuolar hydr
olases; required for endosomal
localization of the CORVET co
mplex; required with YPT52 for
MVB biogenesis and sorting; i
nvolved in autophagy and ionic
stress tolerance; geranylgera
nylation required for membrane
association; protein abundanc
e increases in response to DNA
replication stress; mammalian
Rab5 homolog; VPS21 has a par
alog, YPT53, that arose from t
he whole genome duplication

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_33914(Protein)
MEFYKILVIGDVAVGKTSLVNRVIFNTFEEKYKATIGCEFGLKMMFFEGHEVRIQLWDLA
GQDHLGGISRLYCRDSHGAIVVSDATKPENIQNAEQWKTMVDEQTRLPDGRKIPMVLCLN
KTDLIEDSKKLPDNELQSFADQKGFLSIFYTSNKTGENVNAALDTLIKELIALKLINTSS
LVENKVIKIANDMSKRSLNKKKKCC


>SteCoe_33914(CDS)
ATGGAATTTTACAAAATACTCGTCATAGGCGATGTTGCTGTAGGAAAAACTTCTTTAGTA
AACCGAGTTATATTCAATACATTTGAGGAAAAATACAAAGCTACAATAGGCTGCGAATTT
GGCTTGAAAATGATGTTTTTTGAAGGCCATGAAGTTAGAATACAACTTTGGGATTTAGCA
GGACAAGACCATTTAGGGGGTATTTCTCGGCTATATTGTAGAGATTCTCATGGGGCAATA
GTAGTCTCTGATGCAACAAAACCAGAAAATATCCAAAATGCTGAGCAATGGAAAACAATG
GTAGATGAACAAACACGATTACCAGATGGAAGGAAAATCCCAATGGTCTTATGTCTAAAC
AAAACAGATTTAATTGAAGACTCTAAAAAACTTCCTGATAACGAATTACAATCTTTTGCT
GACCAGAAAGGCTTCCTTTCAATATTCTACACAAGCAACAAAACAGGTGAAAATGTTAAC
GCAGCTTTAGACACTTTAATAAAAGAACTTATTGCCCTTAAACTTATCAATACCTCATCT
TTAGTTGAAAATAAAGTTATAAAAATCGCCAATGATATGAGCAAAAGGTCCTTAAATAAA
AAGAAAAAATGCTGCTGA