Identifiers and Description

Gene Model Identifier

SteCoe_33929

Standard Name

None

Aliases

None

Description

hypothetical protein

Genome Browser

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Saccharomyces CerevisiaeYIL133C1.9792598779469045e-32Ribosomal 60S subunit protein
L16A; N-terminally acetylated,
binds 5.8 S rRNA; transcripti
onally regulated by Rap1p; hom
ologous to mammalian ribosomal
protein L13A and bacterial L1
3; RPL16A has a paralog, RPL16
B, that arose from the whole g
enome duplication; protein abu
ndance increases in response t
o DNA replication stress
Tetrahymena ThermophilaTTHERM_007326401.0806392777072785e-30Homolog of yeast RPL16, Human
RPL13A, Bacteria RPL13; Riboso
mal protein L13 containing pro
tein
Oxytricha TrifallaxContig20852.0.g282.9374821117108028e-30Ribosomal protein L13

WormBaseWBGene000044286.47023492564546e-26

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_33929(Protein)
MFKKVVVVDGRGHLLGRLASVVAKQLLEGQPVTVVRCDEINISGHLANNRIKFMKYLRKR
MNTNPKRGPYHYRAPSMIFFKAVRGMVPRKTPHGQAALARLKVFDGVPHPYDTKKKMVVP
QALRVLKMTPSSQYCVLGDLASSVGWKHQDLVARLEAKRKAKATTWHQSKLDKVKAKEQA
FNKVKGTLGAHLKTIHDSGY


>SteCoe_33929(CDS)
ATGTTTAAGAAGGTAGTTGTTGTAGATGGCCGTGGTCACCTCTTAGGTAGGTTAGCATCA
GTTGTAGCCAAACAACTACTAGAAGGTCAGCCCGTAACAGTGGTGAGATGTGATGAAATA
AACATATCAGGCCACTTGGCAAACAACAGGATAAAGTTTATGAAGTACCTTCGCAAGAGA
ATGAACACTAACCCAAAAAGAGGTCCATATCACTACCGTGCTCCAAGTATGATATTTTTT
AAAGCTGTTCGAGGAATGGTTCCTAGAAAAACTCCTCATGGTCAAGCTGCTCTAGCCAGA
CTAAAAGTCTTTGACGGTGTTCCCCACCCTTATGATACCAAGAAAAAGATGGTTGTCCCT
CAAGCTCTTAGGGTTCTTAAAATGACCCCATCATCTCAGTATTGTGTACTTGGGGATTTA
GCTAGCTCAGTTGGTTGGAAACATCAAGATCTTGTTGCTAGATTAGAAGCAAAACGAAAA
GCTAAGGCTACTACTTGGCATCAGAGCAAGCTTGATAAGGTGAAAGCTAAGGAACAAGCC
TTTAACAAAGTGAAAGGCACACTTGGAGCACATTTGAAGACAATCCATGACTCAGGCTAC
TAG