Identifiers and Description

Gene Model Identifier

SteCoe_34011

Standard Name

None

Aliases

None

Description

hypothetical protein

Genome Browser

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Oxytricha TrifallaxContig11634.0.g750SNF2 family N-terminal domain

WormBaseWBGene000070531.1983630608508849e-70
Saccharomyces CerevisiaeYER164W7.667648073722e-53Chromatin remodeler that regul
ates various aspects of transc
ription; acts in in conjunctio
n with Isw1b to regulate chrom
atin structure and maintain ch
romatin integrity during trans
cription elongation by RNAP II
by preventing trans-histone e
xchange over coding regions; c
ontains a chromo domain, a hel
icase domain and a DNA-binding
domain; component of both the
SAGA and SLIK complexes

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_34011(Protein)
MSIYTSSDDNSDYGGFKSRLGQRRQSQRVNSQRKYLIDESESSQEIDAEELPEIEPWKIV
LKPPIDQILGYRDEKYLVKYKQISYLHLDWLTESEVCEEGKNGRAKLNRFLKDRLNRPTI
DEGKFFDPNFVEVDRVLCTTEIFPVIHPRQACLIVDKWQGKCAVVLSKLMNFRKNNFCYG
IPFLYPVEASMLGGEYYLKKVRYPMDFTTIHSRLYNSYYSFPMEFWKDLGFIFKNCHLCV
EDRLSDIRIVCDTLRQLAIHFYKQWWNLEYGKYTLRWVSLIRNIDVTSPEFLTTDIDETD
FSPAEEEEDQSFNEKHLSDEDLKAQTLDSEADKIFLIKWKNLSYTEVAWEPESLLNCIEK
INDFHRFNKALDTVARQEMIDLNSNFSKFMGLMSDKKRYNPNSAQIQGLINMLDFPTFDA
MSNAQNLNKYPIFKDNRELREYQITGLNWLMKNWGKKRNSILADEMGLGKTIQAIALVNT
LATSFKLRGPYLVLAPLSTLAHWKKTAEDWTSINTVIYHDPNGSEGRDTCRKYELFYTDI
MRRGGLSDKSRLVKFMLLITSFEVFMQDYNKFFTEIPFQMIIIDEAHRLKNKHAKILSFL
KELPCRRYLLMTGTPLQNNTEELWSLLNFIEPKEFFSLNQFLSRYGNLETKEQVEELQEN
IRPYLLRRLKEEVEKSIPPLQETIIDVELTNLQKTYYRAIYERNRTFLCKGTATPQLTNM
EMQLRKCCNHPFLIKGVQQSLGIGMSEDEKLKKMIESSGKMVLLDKLLPKLKTQGKKVLI
FSQFTQMLDLLEEYLHAKWYKYERLDGSVKASDRTASIERFNTEEQQIDIFLLSTRAGGL
GINLTSAQVVIIFDSDWNPQNDVQATARAHRIGQTEEVQVYRLVTARTYEAQMFERASKK
LGLDQAVFSKDTKAEIETLLKFGAYSILEEDSTKSQQFFESNIDEILQTSSRVVNYNVIK
GCYSFSKSSFVSHGSDTSINIDDPNFWNKVLPPQTSLSSRLLTKLNDRSFDAEKQCDEFF
EELELAVNEIIAARNALEVNNEDEDVLTTLLFQVTQTKLFPRPKRHMASKWMNELTRPCR
NRSRTYKGDSPKLVSDSEEEGQENTSKRKVTSFGGIGILCAHCEKEGCKWLCTGPCRRGY
HSKCKDKDLDLAHDSSLPENEEFSALEVIGWKCRDCTNNVATCFQCGQKSTFFAHREDNK
SEGVIKCSLNNCGKFYHISCLPNKPKKRFMCPWHYCVQCKTTGNSKALLQCTRCPKAYHL
RCYNRNVVRLNKKFIVCHQHKQPNKAPTYVSQKAQLKELVHDIKSKLNEYSSKYSYLSMI
EEPKERKERKEHKEPTTKKKRKEKVEDDNESLYAQYKLTKPERFDYENYKGEWCRYCGAR
KSRWGSGPWGRKTLCEAHSFEWKNKRLAEIHNVEIPKSPLFPEKNTELAFLSKLKT


>SteCoe_34011(CDS)
ATGAGTATATACACTAGTTCTGACGATAATTCTGACTATGGCGGATTTAAGTCACGACTT
GGCCAACGAAGACAATCACAACGAGTGAATTCCCAACGAAAGTACCTAATCGACGAATCA
GAAAGTTCTCAAGAAATAGACGCTGAAGAACTTCCAGAAATAGAGCCTTGGAAAATAGTC
CTCAAACCACCAATCGATCAGATTCTGGGATATCGTGATGAAAAGTATTTAGTTAAATAC
AAACAGATATCGTATCTTCATTTGGATTGGCTAACAGAGTCAGAAGTCTGTGAAGAAGGG
AAGAACGGTAGGGCCAAGCTTAATCGTTTTCTTAAAGACCGCCTGAATCGTCCGACTATT
GATGAAGGCAAATTTTTTGACCCTAACTTTGTCGAAGTTGACCGAGTGTTATGCACCACA
GAAATTTTCCCTGTGATACATCCGAGACAAGCTTGTCTAATTGTTGATAAATGGCAAGGC
AAATGCGCAGTAGTGCTAAGTAAGCTCATGAACTTCAGGAAAAACAACTTTTGTTATGGA
ATTCCGTTCTTATACCCTGTTGAAGCTTCGATGCTGGGAGGCGAGTACTACTTAAAGAAA
GTGAGATACCCAATGGACTTTACTACAATCCATAGTAGACTTTACAACAGTTATTATTCC
TTTCCTATGGAGTTTTGGAAAGACTTAGGATTCATCTTTAAGAACTGTCACTTATGTGTG
GAAGATCGTCTTTCTGATATTCGTATAGTATGCGATACTTTACGTCAACTAGCAATACAT
TTCTATAAACAATGGTGGAATCTTGAATATGGAAAATATACTCTAAGATGGGTAAGCCTT
ATTAGAAACATAGATGTGACTAGTCCTGAGTTCTTAACAACCGACATTGACGAGACTGAT
TTTTCCCCAGCAGAAGAAGAAGAAGATCAGTCTTTTAATGAAAAGCATTTATCAGATGAA
GATTTAAAAGCTCAAACTTTAGACTCTGAAGCTGATAAAATCTTTCTAATCAAATGGAAA
AATCTCTCATATACTGAAGTGGCTTGGGAACCTGAGAGTTTGTTAAATTGTATAGAAAAA
ATCAACGACTTTCACAGATTCAACAAAGCTCTAGATACTGTAGCAAGACAAGAAATGATT
GACTTAAACAGCAATTTTTCTAAATTCATGGGTTTGATGAGCGACAAAAAAAGATATAAT
CCAAACAGTGCTCAGATCCAAGGATTGATAAACATGCTTGATTTCCCAACATTTGACGCA
ATGAGTAATGCGCAGAATCTGAATAAATATCCAATTTTTAAAGATAATAGAGAGCTTAGA
GAGTATCAAATTACTGGATTGAATTGGTTAATGAAGAATTGGGGAAAGAAGAGGAATAGC
ATATTGGCTGATGAGATGGGTTTAGGGAAGACTATTCAGGCTATAGCTTTGGTTAATACT
TTAGCAACAAGTTTTAAACTTAGAGGACCATATTTGGTTTTAGCACCATTATCAACTTTG
GCTCATTGGAAAAAAACAGCTGAGGATTGGACGAGTATAAATACGGTAATATATCATGAC
CCTAATGGGTCTGAAGGAAGGGATACTTGTAGGAAATATGAACTTTTTTATACGGATATT
ATGAGGAGAGGAGGACTTTCTGATAAGTCCCGATTGGTTAAGTTTATGTTGCTTATAACG
AGCTTTGAGGTTTTTATGCAGGATTATAATAAGTTCTTTACAGAAATACCATTTCAGATG
ATTATTATTGATGAAGCGCATCGACTGAAAAACAAACATGCGAAAATCCTGAGCTTTTTA
AAGGAACTTCCCTGCAGGAGATATTTATTAATGACTGGTACTCCACTCCAAAACAACACA
GAGGAGTTATGGAGTTTACTAAATTTCATTGAACCAAAAGAGTTCTTCAGTCTGAATCAA
TTTCTTTCAAGGTATGGCAACCTAGAAACTAAAGAACAAGTTGAAGAGCTTCAAGAAAAT
ATACGCCCATACCTCCTCAGACGTTTAAAAGAAGAAGTTGAAAAAAGTATCCCTCCTCTT
CAAGAAACCATAATAGATGTTGAGCTTACCAATCTTCAAAAAACTTATTATCGGGCAATT
TATGAACGGAATCGTACATTTTTATGTAAAGGTACAGCAACACCTCAGCTGACAAATATG
GAAATGCAACTACGTAAATGTTGTAATCATCCATTTCTTATAAAAGGTGTGCAACAAAGT
CTAGGAATTGGGATGTCTGAAGATGAAAAACTTAAAAAAATGATCGAAAGTTCAGGGAAA
ATGGTCCTTCTCGATAAGCTTCTACCCAAACTGAAAACCCAAGGGAAAAAAGTGCTGATT
TTTTCACAGTTCACACAAATGCTTGATTTACTAGAAGAGTACCTCCATGCTAAATGGTAC
AAATATGAAAGACTTGATGGGTCTGTTAAAGCTTCAGACCGAACAGCGAGTATTGAGCGT
TTTAATACAGAAGAACAACAAATTGATATATTTTTATTATCAACAAGAGCTGGAGGGCTT
GGTATTAATTTGACCTCAGCCCAAGTTGTCATTATTTTTGATAGTGATTGGAACCCACAA
AATGATGTACAAGCTACAGCTAGAGCACATAGAATAGGGCAAACTGAAGAAGTTCAAGTT
TATCGTTTAGTAACTGCAAGAACTTATGAAGCACAAATGTTTGAAAGAGCTTCGAAAAAA
CTTGGATTAGACCAAGCTGTGTTTTCTAAAGACACTAAAGCTGAAATTGAAACTTTATTA
AAGTTTGGAGCTTATAGCATTTTAGAAGAAGACTCTACAAAAAGCCAACAGTTTTTCGAA
AGTAATATTGATGAGATTTTACAAACTTCATCAAGAGTCGTCAATTATAATGTTATTAAA
GGATGCTATAGTTTTAGTAAGAGTTCATTTGTATCTCATGGCTCTGATACAAGTATTAAT
ATTGATGACCCTAATTTTTGGAATAAAGTTTTACCTCCACAAACTTCACTTTCTTCAAGG
TTGCTTACAAAGCTTAATGATAGGAGTTTTGATGCAGAGAAACAATGTGATGAGTTTTTT
GAGGAACTTGAATTGGCGGTTAATGAGATAATAGCAGCAAGAAATGCTTTAGAAGTTAAT
AATGAAGATGAAGATGTTTTGACTACACTTCTTTTTCAAGTCACACAAACAAAACTATTT
CCTAGACCAAAACGTCATATGGCTTCAAAATGGATGAATGAATTAACTAGACCTTGTCGT
AATAGAAGTCGTACTTATAAAGGTGACTCACCTAAACTTGTAAGTGATAGTGAAGAAGAA
GGTCAAGAAAATACAAGTAAACGTAAAGTCACAAGTTTTGGTGGTATAGGGATATTATGT
GCACATTGTGAAAAAGAAGGATGCAAATGGCTTTGTACAGGCCCATGTCGTAGAGGGTAT
CATTCGAAATGTAAAGATAAAGATTTAGATCTAGCTCATGATAGCTCCCTTCCAGAAAAT
GAAGAATTTAGTGCTTTGGAAGTTATTGGGTGGAAATGTAGGGATTGCACTAATAATGTT
GCAACTTGTTTCCAATGTGGACAGAAAAGCACTTTTTTTGCACATCGAGAAGATAATAAA
TCTGAAGGGGTAATAAAATGCTCTTTAAACAACTGTGGAAAATTCTATCACATCTCCTGC
CTACCCAATAAGCCGAAAAAACGATTCATGTGTCCTTGGCATTACTGCGTACAGTGCAAG
ACAACAGGTAATTCTAAAGCTTTACTTCAGTGTACAAGATGCCCAAAAGCTTATCATCTT
CGTTGTTATAACCGTAACGTCGTCCGACTAAATAAAAAATTCATAGTCTGCCATCAGCAT
AAACAACCAAACAAAGCTCCAACTTATGTTTCCCAAAAAGCTCAACTTAAAGAACTTGTT
CATGACATCAAAAGTAAACTTAATGAATACTCATCAAAATATTCATATTTAAGTATGATA
GAAGAACCTAAAGAGCGTAAAGAACGTAAAGAGCATAAAGAGCCAACGACAAAGAAAAAA
AGAAAGGAAAAGGTTGAAGATGATAATGAAAGTTTATATGCTCAATACAAACTGACAAAG
CCCGAAAGATTTGATTATGAAAATTACAAAGGTGAATGGTGTCGTTATTGTGGGGCGAGG
AAATCACGCTGGGGAAGTGGTCCTTGGGGTAGGAAAACATTATGTGAAGCTCATTCCTTT
GAATGGAAAAACAAAAGATTAGCTGAAATTCATAATGTTGAGATACCAAAATCCCCGTTG
TTTCCTGAAAAAAACACTGAACTCGCGTTTTTATCTAAACTCAAAACGTAA